World-2DPAGE Home
Home  |  Contact


World-2DPAGE Repository 
Search by  [accession number] *
[description, ID or gene] 
[author names] 
[spot ID / serial number] 
[identification methods] 
[pI / Mw range] 
[combined fields] 

Maps  [experimental info] 
[protein list] 
[graphical interface]

     Databases

use 'Ctrl' to select several
databases


Select Remote Interfaces
[All Interfaces]
SWISS-2DPAGE
World-2DPAGE Portal

Exclude local DBs
has only effect if a remote
interface is selected
     
Searching in 'World-2DPAGE Repository [0004]' for entry matching: ATPB_RAT




World-2DPAGE Repository (0004): ATPB_RAT



ATPB_RAT:

Nice View - a user-friendly view of this entry
ID   ATPB_RAT;
AC   P10719;
DT   13-Oct-2008, integrated into [0004] - Proteome profile of the mature rat
DT   Olfactory bulb (release 1).
DT   18-May-2011, 2D annotation version 2.
DT   22-Dec-2011, general annotation version 2.
DE   RecName: Full=ATP synthase subunit beta, mitochondrial; EC=3.6.3.14;
DE   Flags: Precursor;.
GN   Name=Atp5b;
OS   Rattus norvegicus (Rat).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;
OC   Muroidea; Muridae; Murinae; Rattus.
OX   NCBI_TaxID=10116;
IM   OB21DSUB.
RN   [1]
RP   MAPPING ON GEL.
RX   PubMed=19343716; DOI=10.1002/pmic.200800664; [NCBI, EBI, Israel, Japan]
RA   Maurya D.K., Sundaram C.S., Bhargava P.;
RT   ''Proteome profile of the mature rat olfactory bulb'';
RL   Proteomics 9(1):2593-2599 (2009).
2D   -!- MASTER: OB21DSUB;
2D   -!-   PI/MW: SPOT 373=4.78/50000;
2D   -!-   PEPTIDE MASSES: SPOT 373: 1038.6235; 1278.6752; 1385.7509;
2D         1401.7396; 1406.7268; 1435.7926; 1601.8574; 1650.9573; 1831.9027;
2D         1919.1407; 1922.0114; 1988.0708; 2039.0228; 2077.0068; 2266.137;
2D         2282.1208; 2334.1582; 2691.3984; 3714.8994; 3842.988; TRYPSIN.
2D   -!-   PEPTIDE SEQUENCES: SPOT 373: LVLEVAQHLGESTVR,95-109;
2D         TIAMoxDGTEGLVR,110-121; VLDSGAPIKIPVGPETLGR,125-143; IPVGPETLGR,134-143;
2D         IMNVIGEPIDER,144-155; IMoxNVIGEPIDER,144-155; AHGGYSVFAGVGER,226-239;
2D         TREGNDLYHEMoxIESGVINLK,240-259; EGNDLYHEMoxIESGVINLK,242-259;
2D         VALVYGQMNEPPGAR,265-279; DQEGQDVLLFIDNIFR,295-310;
2D         FTQAGSEVSALLGR,311-324; IPSAVGYQPTLATDMGTMQER,325-345;
2D         IPSAVGYQPTLATDMoxGTMQER,325-345;
2D         KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR,351-387;
2D         GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR,352-387;
2D         AIAELGIYPAVDPLDSTSR,388-406; IMoxDPNIVGSEHYDVAR,407-422;
2D         SLQDIIAILGMoxDELSEEDKLTVSR,433-456; FLSQPFQVAEVFTGHMoxGK,463-480.
2D   -!-   MAPPING: SPOT 373: Peptide mass fingerprinting [1]; SPOT 373:
2D         Tandem mass spectrometry [1].
CC   ---------------------------------------------------------------------------
CC   Data from Dr. Purnima Bhargava, Centre for Cellular and Molecular Biology, India
CC   ---------------------------------------------------------------------------
DR   UniProtKB/Swiss-Prot; P10719; ATPB_RAT.
//


The following 2-D map is available for this protein:
2-DE gel for Olfactory bulb proteome
OB21DSUB


World-2DPAGE Repository image

World-2DPAGE Repository (search AC)


Database constructed and maintained by SIB, using the Make2D-DB II package (ver. 3.10.2) from the World-2DPAGE Constellation of the ExPASy web server