World-2DPAGE Home
Home  |  Contact


World-2DPAGE Repository 
Search by  [accession number] *
[description, ID or gene] 
[author names] 
[spot ID / serial number] 
[identification methods] 
[pI / Mw range] 
[combined fields] 

Maps  [experimental info] 
[protein list] 
[graphical interface]

     Databases

use 'Ctrl' to select several
databases


Select Remote Interfaces
[All Interfaces]
SWISS-2DPAGE
World-2DPAGE Portal

Exclude local DBs
has only effect if a remote
interface is selected
     
Searching in 'World-2DPAGE Repository [0004]' for entry matching: P07323




World-2DPAGE Repository (0004): P07323



P07323:

Nice View - a user-friendly view of this entry
ID   ENOG_RAT;
AC   P07323;
DT   13-Oct-2008, integrated into [0004] - Proteome profile of the mature rat
DT   Olfactory bulb (release 1).
DT   18-May-2011, 2D annotation version 2.
DT   22-Dec-2011, general annotation version 2.
DE   RecName: Full=Gamma-enolase; EC=4.2.1.11; AltName:
DE   Full=2-phospho-D-glycerate hydro-lyase; AltName: Full=Enolase 2; AltName:
DE   Full=Neural enolase; AltName: Full=Neuron-specific enolase; Short=NSE;.
GN   Name=Eno2; Synonyms=Eno-2;
OS   Rattus norvegicus (Rat).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;
OC   Muroidea; Muridae; Murinae; Rattus.
OX   NCBI_TaxID=10116;
IM   OB21DSUB.
RN   [1]
RP   MAPPING ON GEL.
RX   PubMed=19343716; DOI=10.1002/pmic.200800664; [NCBI, EBI, Israel, Japan]
RA   Maurya D.K., Sundaram C.S., Bhargava P.;
RT   ''Proteome profile of the mature rat olfactory bulb'';
RL   Proteomics 9(1):2593-2599 (2009).
2D   -!- MASTER: OB21DSUB;
2D   -!-   PI/MW: SPOT 401=5.03/47000;
2D   -!-   PEPTIDE MASSES: SPOT 401: 840.4045; 848.4196; 1130.6179; 1174.5775;
2D         1588.7717; 1604.7611; 1620.7512; 1804.967; 1855.9094; 1955.0031;
2D         1970.9893; 2102.1211; 2220.1328; 2353.1714; 2578.3804; 2702.3206;
2D         3024.6111; TRYPSIN.
2D   -!-   PEPTIDE SEQUENCES: SPOT 401: AAVPSGASTGIYEALELR,32-49;
2D         AAVPSGASTGIYEALELRDGDK,32-53; AVDHINSTIAPALISSGLSVVEQEK,64-88;
2D         HIAQLAGNSDLILPVPAFNVINGGSHAGNK,132-161; LAMoxQEFMILPVGAESFR,162-178;
2D         LAMoxQEFMoxILPVGAESFR,162-178; LGAEVYHTLK,183-192;
2D         DATNVGDEGGFAPNILENSEALELVK,202-227; MoxVIGMDVAASEFYR,239-252;
2D         MoxVIGMoxDVAASEFYR,239-252; MVIGMDVAASEFYR,239-252;
2D         CITGDQLGALYQDFVR,269-284; FTANVGIQIVGDDLTVTNPK,306-325;
2D         SGETEDTFIADLVVGLCTGQIK,372-393; YNQLMoxR,406-411; IEEELGEEAR,412-421; FAGHNFR,422-428.
2D   -!-   MAPPING: SPOT 401: Peptide mass fingerprinting [1]; SPOT 401:
2D         Tandem mass spectrometry [1].
CC   ---------------------------------------------------------------------------
CC   Data from Dr. Purnima Bhargava, Centre for Cellular and Molecular Biology, India
CC   ---------------------------------------------------------------------------
DR   UniProtKB/Swiss-Prot; P07323; ENOG_RAT.
//


The following 2-D map is available for this protein:
2-DE gel for Olfactory bulb proteome
OB21DSUB


World-2DPAGE Repository image

World-2DPAGE Repository (search AC)


Database constructed and maintained by SIB, using the Make2D-DB II package (ver. 3.10.2) from the World-2DPAGE Constellation of the ExPASy web server