World-2DPAGE Home
Home  |  Contact


World-2DPAGE Repository 
Search by  [accession number] *
[description, ID or gene] 
[author names] 
[spot ID / serial number] 
[identification methods] 
[pI / Mw range] 
[combined fields] 

Maps  [experimental info] 
[protein list] 
[graphical interface]

     Databases

use 'Ctrl' to select several
databases


Select Remote Interfaces
[All Interfaces]
SWISS-2DPAGE
World-2DPAGE Portal

Exclude local DBs
has only effect if a remote
interface is selected
     
Searching in 'World-2DPAGE Repository [0004]' for entry matching: Q561S0




World-2DPAGE Repository (0004): Q561S0



Q561S0:

Nice View - a user-friendly view of this entry
ID   NDUAA_RAT;
AC   Q561S0;
DT   13-Oct-2008, integrated into [0004] - Proteome profile of the mature rat
DT   Olfactory bulb (release 1).
DT   18-May-2011, 2D annotation version 2.
DT   22-Dec-2011, general annotation version 2.
DE   RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit
DE   10, mitochondrial; AltName: Full=Complex I-42kD; Short=CI-42kD; AltName:
DE   Full=NADH-ubiquinone oxidoreductase 42 kDa subunit; Flags: Precursor;.
GN   Name=Ndufa10;
OS   Rattus norvegicus (Rat).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;
OC   Muroidea; Muridae; Murinae; Rattus.
OX   NCBI_TaxID=10116;
IM   OB21DSUB.
RN   [1]
RP   MAPPING ON GEL.
RX   PubMed=19343716; DOI=10.1002/pmic.200800664; [NCBI, EBI, Israel, Japan]
RA   Maurya D.K., Sundaram C.S., Bhargava P.;
RT   ''Proteome profile of the mature rat olfactory bulb'';
RL   Proteomics 9(1):2593-2599 (2009).
2D   -!- MASTER: OB21DSUB;
2D   -!-   PI/MW: SPOT 461=5.89/42000;
2D   -!-   PEPTIDE MASSES: SPOT 461: 1123.6066; 1433.6991; 1461.7061;
2D         1498.7471; 1615.7893; 1743.8794; 2316.0955; 2379.0334; 2441.3008;
2D         2657.3892; 2849.5325; 3488.5442; TRYPSIN.
2D   -!-   PEPTIDE SEQUENCES: SPOT 461: HYPEAGIQYSSSTTGDGRPLDIEFSGSCSLEK,3-34;
2D         LQSWLYASR,49-57; LLQYSDALEHLLSTGQGVVLER,58-79;
2D         SIYSDFVFLEAMoxYNQGFIR,80-98; KQCVDHYNEIK,99-109; QCVDHYNEIKR,100-110;
2D         LTLPEYLPPHAVIYIDVPVSEIQSR,111-135; VTSAYLQDIEDAYK,147-160;
2D         VTSAYLQDIEDAYKK,147-161; MoxSEICEVLVYSSWEAEDSTK,167-186;
2D         VVEDIEYLNYNK,187-198; EVLNYTTVPVYLPEITIGAHQGSR,221-244.
2D   -!-   MAPPING: SPOT 461: Peptide mass fingerprinting [1]; SPOT 461:
2D         Tandem mass spectrometry [1].
CC   ---------------------------------------------------------------------------
CC   Data from Dr. Purnima Bhargava, Centre for Cellular and Molecular Biology, India
CC   ---------------------------------------------------------------------------
DR   UniProtKB/Swiss-Prot; Q561S0; NDUAA_RAT.
//


The following 2-D map is available for this protein:
2-DE gel for Olfactory bulb proteome
OB21DSUB


World-2DPAGE Repository image

World-2DPAGE Repository (search AC)


Database constructed and maintained by SIB, using the Make2D-DB II package (ver. 3.10.2) from the World-2DPAGE Constellation of the ExPASy web server