World-2DPAGE Home
Home  |  Contact


World-2DPAGE Repository 
Search by  [accession number] 
[description, ID or gene] 
[author names] 
[spot ID / serial number] *
[identification methods] 
[pI / Mw range] 
[combined fields] 

Maps  [experimental info] 
[protein list] 
[graphical interface]

     Databases

use 'Ctrl' to select several
databases


Select Remote Interfaces
[All Interfaces]
SWISS-2DPAGE
World-2DPAGE Portal

Exclude local DBs
has only effect if a remote
interface is selected
     

Searching in 'World-2DPAGE Repository [0004]' experimental data (all)
for spot names matching (exactly): '268'
on the 'OB21DSUB' map.



Searched entry

Spot ID AC
(ID)
PMF Tandem MS Identified peptides Amino acid composition
268 Q62950
(DPYL1_RAT)



922.5267; 1000.5927; 1001.5743; 1314.7102; 1405.7859; 1802.8959; 2065.0491; 2175.168; 2199.0337; 2215.0315; 2227.0464; 2331.167; 2403.189; 2531.2751; 2781.3157; 2797.3044; 2841.4683; 2951.4788; 2967.4897; 3389.6189; 3405.6006; TRYPSIN

no data IINDDQSFYADVYLEDGLIK,24-43; QIGENLIVPGGVKTIEANGR,44-63; MoxVIPGGIDVNTYLQKPSQGMoxTSADDFFQGTR,64-94; MoxVIPGGIDVNTYLQKPSQGMTSADDFFQGTR,64-94; AALAGGTTMIIDHVVPEPGSSLLTSFEK,95-122; DLYQMoxSDSQLYEAFTFLK,172-189; DLYQMSDSQLYEAFTFLK,172-189; GLGAVILVHAENGDLIAQEQK,190-210; ILEMGITGPEGHALSRPEELEAEAVFR,212-238; ILEMoxGITGPEGHALSRPEELEAEAVFR,212-238; SAADIIALAR,259-268; KGPLVFGEPIAASLGTDGTHYWSK,270-293; GPLVFGEPIAASLGTDGTHYWSK,271-293; DNFTLIPEGVNGIEER,346-361; MTVVWDKAVATGK,362-374; IFNLYPR,391-397; STVEYNIFEGMECcamHGSPLVVISQGK,427-451; STVEYNIFEGMoxECcamHGSPLVVISQGK,427-451; KPFPEHLYQR,472-481; VFGLHSVSR,488-496; NLHQSNFSLSGAQIDDNNPR,533-552 no data


World-2DPAGE Repository image

World-2DPAGE Repository (search Spot)


Database constructed and maintained by SIB, using the Make2D-DB II package (ver. 3.10.2) from the World-2DPAGE Constellation of the ExPASy web server