World-2DPAGE Home
Home  |  Contact


World-2DPAGE Repository 
Search by  [accession number] 
[description, ID or gene] 
[author names] 
[spot ID / serial number] *
[identification methods] 
[pI / Mw range] 
[combined fields] 

Maps  [experimental info] 
[protein list] 
[graphical interface]

     Databases

use 'Ctrl' to select several
databases


Select Remote Interfaces
[All Interfaces]
SWISS-2DPAGE
World-2DPAGE Portal

Exclude local DBs
has only effect if a remote
interface is selected
     

Searching in 'World-2DPAGE Repository [0004]' experimental data (Tandem MS)
for spot names matching (exactly): '401'
on the 'OB21DSUB' map.



Searched entry

Spot ID AC
(ID)
Tandem MS Identified peptides
401 P07323
(ENOG_RAT)
no data AAVPSGASTGIYEALELR,32-49; AAVPSGASTGIYEALELRDGDK,32-53; AVDHINSTIAPALISSGLSVVEQEK,64-88; HIAQLAGNSDLILPVPAFNVINGGSHAGNK,132-161; LAMoxQEFMILPVGAESFR,162-178; LAMoxQEFMoxILPVGAESFR,162-178; LGAEVYHTLK,183-192; DATNVGDEGGFAPNILENSEALELVK,202-227; MoxVIGMDVAASEFYR,239-252; MoxVIGMoxDVAASEFYR,239-252; MVIGMDVAASEFYR,239-252; CITGDQLGALYQDFVR,269-284; FTANVGIQIVGDDLTVTNPK,306-325; SGETEDTFIADLVVGLCTGQIK,372-393; YNQLMoxR,406-411; IEEELGEEAR,412-421; FAGHNFR,422-428


World-2DPAGE Repository image

World-2DPAGE Repository (search Spot)


Database constructed and maintained by SIB, using the Make2D-DB II package (ver. 3.10.2) from the World-2DPAGE Constellation of the ExPASy web server