resource logo

World-2DPAGE Repository

Attention: World-2DPAGE is no longer maintained. Previously submitted data can still be queried at World-2DPAGE Repository.

[Click to access protein entry]
 Spot: 373 (ob21dsub)
 pI: 4.78 Mw: 50000
 %vol: 0.108265   %od: 0.193087
 ================
 *ATPB_RAT*
  accession n°: P10719

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LVLEVAQHLGESTVR;; $m/Z=TIAMoxDGTEGLVR;; $m/Z=VLDSGAPIKIPVGPETLGR;; $m/Z=IPVGPETLGR;; $m/Z=IMNVIGEPIDER;; $m/Z=IMoxNVIGEPIDER;; $m/Z=AHGGYSVFAGVGER;; $m/Z=TREGNDLYHEMoxIESGVINLK;; $m/Z=EGNDLYHEMoxIESGVINLK;; $m/Z=VALVYGQMNEPPGAR;; $m/Z=DQEGQDVLLFIDNIFR;; $m/Z=FTQAGSEVSALLGR;; $m/Z=IPSAVGYQPTLATDMGTMQER;; $m/Z=IPSAVGYQPTLATDMoxGTMQER;; $m/Z=KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR;; $m/Z=GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR;; $m/Z=AIAELGIYPAVDPLDSTSR;; $m/Z=IMoxDPNIVGSEHYDVAR;; $m/Z=SLQDIIAILGMoxDELSEEDKLTVSR;; $m/Z=FLSQPFQVAEVFTGHMoxGK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1038.6235 (0), 1278.6752 (0), 1385.7509 (0),
  1401.7396 (0), 1406.7268 (0), 1435.7926 (0), 1601.8574 (0),
  1650.9573 (0), 1831.9027 (0), 1919.1407 (0), 1922.0114 (0),
  1988.0708 (0), 2039.0228 (0), 2077.0068 (0), 2266.137 (0),
  2282.1208 (0), 2334.1582 (0), 2691.3984 (0), 3714.8994 (0),
  3842.988 (0) }
World-2DPAGE Repository image

 World-2DPAGE Repository Viewer (0004)
 OB21DSUB { 2-DE gel for Olfactory bulb proteome } (AC: P10719)

Home page of the World-2DPAGE Repository
             Back to the
World-2DPAGE Repository imagesearch engine

Switch to Gel: 

Database: 

Re-scale Gel from 100% to:  View: 


      Display:   Identified spots    Identification details:  show hide
details:  PMF  Tandem MS  AA Composition  Micro-Sequencing / Tagging  Gel Matching  Comigration  Immunobloting
 

  -Get more information by dragging your mouse pointer over any highlighted spot  -Click on a highlighted spot to access all its associated protein entries
/repository/data/gifs/submission_0004/OB21DSUB.jpg
Back to the
World-2DPAGE Repository imagesearch engine