resource logo

World-2DPAGE Repository

Attention: World-2DPAGE is no longer maintained.

World-2DPAGE Repository no longer accepts submissions.
[Click to access protein entry]
 Spot: 461 (ob21dsub)
 pI: 5.89 Mw: 42000
 %vol: 0.0347105   %od: 0.117451
 ================
 *NDUAA_RAT*
  accession n°: Q561S0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HYPEAGIQYSSSTTGDGRPLDIEFSGSCSLEK;; $m/Z=LQSWLYASR;; $m/Z=LLQYSDALEHLLSTGQGVVLER;; $m/Z=SIYSDFVFLEAMoxYNQGFIR;; $m/Z=KQCVDHYNEIK;; $m/Z=QCVDHYNEIKR;; $m/Z=LTLPEYLPPHAVIYIDVPVSEIQSR;; $m/Z=VTSAYLQDIEDAYK;; $m/Z=VTSAYLQDIEDAYKK;; $m/Z=MoxSEICEVLVYSSWEAEDSTK;; $m/Z=VVEDIEYLNYNK;; $m/Z=EVLNYTTVPVYLPEITIGAHQGSR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1123.6066 (0), 1433.6991 (0), 1461.7061 (0),
  1498.7471 (0), 1615.7893 (0), 1743.8794 (0), 2316.0955 (0),
  2379.0334 (0), 2441.3008 (0), 2657.3892 (0), 2849.5325 (0),
  3488.5442 (0) }
World-2DPAGE Repository image

 World-2DPAGE Repository Viewer (0004)
 OB21DSUB { 2-DE gel for Olfactory bulb proteome } (AC: Q561S0)

Home page of the World-2DPAGE Repository
             Back to the
World-2DPAGE Repository imagesearch engine

Switch to Gel: 

Database: 

Re-scale Gel from 100% to:  View: 


      Display:   Identified spots    Identification details:  show hide
details:  PMF  Tandem MS  AA Composition  Micro-Sequencing / Tagging  Gel Matching  Comigration  Immunobloting
 

  -Get more information by dragging your mouse pointer over any highlighted spot  -Click on a highlighted spot to access all its associated protein entries
/repository/data/gifs/submission_0004/OB21DSUB.jpg
Back to the
World-2DPAGE Repository imagesearch engine