World-2DPAGE Home
Home  |  Contact
[Click to access protein entry]
 Spot: 591 (ob21dsub)
 pI: 5.86 Mw: 30000
 %vol: 0.0357633   %od: 0.0521544
 ================
 *PSB7_RAT*
  accession n°: Q9JHW0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DGIVLGADTR;; $m/Z=MLKQMLFR;; $m/Z=YQGYIGAALVLGGVDVTGPHLYSIYPHGSTDK;; $m/Z=LPYVTMoxGSGSLAAMoxAVFEDK;; $m/Z=FRPDMoxEEEEAK;; $m/Z=FRPDMoxEEEEAKK;; $m/Z=LDFLRPYSVPNKK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1016.5797 (0), 1066.5514 (0), 1396.6536 (0),
  1524.7445 (0), 1576.9519 (0), 2119.0261 (0), 3348.679 (0)
  }
World-2DPAGE Repository image

 World-2DPAGE Repository Viewer (0004)
 OB21DSUB { 2-DE gel for Olfactory bulb proteome } (AC: Q9JHW0)

Home page of the World-2DPAGE Repository
             Back to the
World-2DPAGE Repository imagesearch engine

Switch to Gel: 

Database: 

Re-scale Gel from 100% to:  View: 


      Display:   Identified spots    Identification details:  show hide
details:  PMF  Tandem MS  AA Composition  Micro-Sequencing / Tagging  Gel Matching  Comigration  Immunobloting
 

  -Get more information by dragging your mouse pointer over any highlighted spot  -Click on a highlighted spot to access all its associated protein entries
/repository/data/gifs/submission_0004/OB21DSUB.jpg
Back to the
World-2DPAGE Repository imagesearch engine