World-2DPAGE Home
Home  |  Contact
[Click to access protein entry]
 Spot: 2D-001WDM (ecoli-dige4.5-6.5)
 pI: 5.18 Mw: 77774
 %vol: 0.0780837   %od: 0.0349903
 ================
 *KATG_ECOLI*
  accession n°: P13029

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)FLNDPQAFNEAFAR(A);; $m/Z=(R)ADLVFGSNSVLR(A);; $m/Z=(K)ASLADIIVLAGVVGVEK(A);; $m/Z=(K)ESGKASLADIIVLAGVVGVEK(A) }
[Click to access protein entry]
 Spot: 2D-001WT3 (ecoli-dige4.5-6.5)
 pI: 5.09 Mw: 26148
 %vol: 0.201783   %od: 0.249229
 ================
 *PUR7_ECOLI*
  accession n°: P0A7D7

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 869.47 (0), 1065.51 (0), 1331.7 (0), 1563.8 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WFT (ecoli-dige4.5-6.5)
 pI: 4.93 Mw: 61278
 %vol: 0.219135   %od: 0.201438
 ================
 *CH60_ECOLI*
  accession n°: P0A6F5

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 921.54 (0), 1201.59 (0), 1454.68 (0), 1567.89 (0), 1711.78 (0),
  1760.96 (0), 1845.93 (0), 1957.01 (0), 2042.92 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WJO (ecoli-dige4.5-6.5)
 pI: 4.96 Mw: 48103
 %vol: 0.133067   %od: 0.105834
 ================
 *ATPB_ECOLI*
  accession n°: P0ABB4

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 900.55 (0), 961.51 (0), 1138.57 (0), 1831.03 (0), 1841.01 (0),
  2003.13 (0) }
[Click to access protein entry]
 Spot: 2D-001WWA (ecoli-dige4.5-6.5)
 pI: 4.99 Mw: 19656
 %vol: 0.294876   %od: 0.588358
 ================
 *TPX_ECOLI*
  accession n°: P0A862

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)KVLNIFPSIDTGVCAASVR(K);; $m/Z=(K)DLSDVTLGQFAGK(R);; $m/Z=(K)AQTFTLVAK(D);; $m/Z=(-)SQTVHFQGNPVTVANSIPQAGSK(A);; $m/Z=(R)NAEFLQAYGVAIADGPLK(G);; $m/Z=(R)FCGAEGLNNVITLSTFR(N);; $m/Z=(R)KFNQLATEIDNTVVLCISADLPFAQSR;; $m/Z=(K)VLNIFPSIDTGVCAASVRK(F) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 978.48 (0), 1350.57 (0), 1506.68 (0), 1876.8 (0), 1898.78 (0),
  1918.84 (0), 2046.92 (0), 2345.04 (0), 3804.31 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WUC (ecoli-dige4.5-6.5)
 pI: 4.68 Mw: 24436
 %vol: 0.0649367   %od: 0.0841349
 ================
 *RIMM_ECOLI*
  accession n°: P0A7X6

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LVPFLDGQVIK(K) }
[Click to access protein entry]
 Spot: 2D-001WH6 (ecoli-dige4.5-6.5)
 pI: 5.93 Mw: 55635
 %vol: 0.252508   %od: 0.157891
 ================
 *OPPA_ECOLI*
  accession n°: P23843

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 992.59 (0), 1020.52 (0), 1094.55 (0), 1274.75 (0), 1629.9 (0),
  2001.9 (0), 2017.91 (0), 2134.95 (0) }
[Click to access protein entry]
 Spot: 2D-001WL3 (ecoli-dige4.5-6.5)
 pI: 5.35 Mw: 43401
 %vol: 2.42357   %od: 4.74798
 ================
 *ENO_ECOLI*
  accession n°: P0A6P9

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)FGANAILAVSLANAK(A);; $m/Z=(K)AFTSEEFTHFLEELTK(Q);; $m/Z=(K)IQLVGDDLFVTNTK(I);; $m/Z=(K)GIANSILIK(F);; $m/Z=(K)FNQIGSLTETLAAIK(M);; $m/Z=(R)IEEALGEK(A);; $m/Z=(K)AVAAVNGPIAQALIGK(D) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 928.49 (0), 950.42 (0), 1189.48 (0), 1255.48 (0), 1459.67 (0),
  1492.7 (0), 1562.68 (0), 1605.7 (0), 1675.73 (0), 1928.75 (0),
  2117.9 (0) }
[Click to access protein entry]
 Spot: 2D-001WOL (ecoli-dige4.5-6.5)
 pI: 5.48 Mw: 36267
 %vol: 0.275661   %od: 0.287702
 ================
 *POTF_ECOLI*
  accession n°: P31133

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 941.5 (0), 1113.64 (0), 1327.71 (0), 1712.9 (0), 1849.82 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WPP (ecoli-dige4.5-6.5)
 pI: 5.50 Mw: 33875
 %vol: 0.922367   %od: 1.20957
 ================
 *OMPA_ECOLI*
  accession n°: P0A910

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 915.49 (0), 1055.46 (0), 1083.54 (0), 1155.63 (0), 1214.67 (0),
  1280.71 (0), 1795.79 (0) }
[Click to access protein entry]
 Spot: 2D-001WEH (ecoli-dige4.5-6.5)
 pI: 4.97 Mw: 68742
 %vol: 1.64167   %od: 3.26619
 ================
 *RS1_ECOLI*
  accession n°: P0AG67

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1162.66 (0), 1204.7 (0), 1525.96 (0), 1549.87 (0), 1566.79 (0),
  1675.85 (0), 1712.97 (0) }
[Click to access protein entry]
 Spot: 2D-001WSD (ecoli-dige4.5-6.5)
 pI: 5.14 Mw: 27701
 %vol: 0.747038   %od: 0.935688
 ================
 *HISJ_ECOLI*
  accession n°: P0AEU0

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1079.5 (0), 1123.58 (0), 1235.67 (0), 1330.67 (0), 1504.67 (0),
  1551.7 (0), 1605.77 (0), 1810.87 (0) }
[Click to access protein entry]
 Spot: 2D-001WXD (ecoli-dige4.5-6.5)
 pI: 5.15 Mw: 16000
 %vol: 0.0539187   %od: 0.0848323
 ================
 *OMPX_ECOLI*
  accession n°: P0A917

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TASSGDYNKNQYYGITAGPAYR(I);; $m/Z=(K)YRYEEDNSPLGVIGSFTYTEK(S);; $m/Z=(K)FQTTEYPTYK(H) }
[Click to access protein entry]
 Spot: 2D-001WU6 (ecoli-dige4.5-6.5)
 pI: 5.37 Mw: 24787
 %vol: 0.0734529   %od: 0.104977
 ================
 *ZINT_ECOLI*
  accession n°: P76344

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AANGVFDDANVQNR(T) }
[Click to access protein entry]
 Spot: 2D-001WTA (ecoli-dige4.5-6.5)
 pI: 5.51 Mw: 25962
 %vol: 0.603911   %od: 0.858693
 ================
 *TPIS_ECOLI*
  accession n°: P0A858

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ADAFAVIVK(A);; $m/Z=(K)SATPAQAQAVHK(F);; $m/Z=(K)TQGAAAFEGAVIAYEPVWAIGTGK(S);; $m/Z=(K)EQGLTPVLCIGETEAENEAGKTEEVCAR(Q) }
[Click to access protein entry]
 Spot: 2D-001WPC (ecoli-dige4.5-6.5)
 pI: 4.45 Mw: 34596
 %vol: 0.0696738   %od: 0.078887
 ================
 *YBBN_ECOLI*
  accession n°: P77395

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 961.42 (0), 1024.63 (0), 1112.56 (0), 1175.56 (0), 1186.52 (0),
  1374.79 (0), 1805.94 (0), 1853.8 (0), 1934.05 (0), 2542.44 (0),
  2971.49 (0) }
[Click to access protein entry]
 Spot: 2D-001WKP (ecoli-dige4.5-6.5)
 pI: 5.11 Mw: 44335
 %vol: 0.302488   %od: 0.302844
 ================
 *IDH_ECOLI*
  accession n°: P08200

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 906.44 (0), 1030.49 (0), 1124.65 (0), 1139.61 (0), 1206.65 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WMY (ecoli-dige4.5-6.5)
 pI: 5.49 Mw: 39104
 %vol: 0.902992   %od: 1.79366
 ================
 *ALF_ECOLI*
  accession n°: P0AB71

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 955.51 (0), 1502.78 (0), 1762.98 (0), 1878.01 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WUX (ecoli-dige4.5-6.5)
 pI: 5.09 Mw: 23123
 %vol: 0.727397   %od: 1.07836
 ================
 *AHPC_ECOLI*
  accession n°: P0AE08

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1179.61 (0), 1216.62 (0), 1684.85 (0), 1697.8 (0), 1890.03 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WU7 (ecoli-dige4.5-6.5)
 pI: 4.99 Mw: 24831
 %vol: 0.0789353   %od: 0.0820449
 ================
 *HIS4_ECOLI*
  accession n°: P10371

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1359.73 (0), 1529.82 (0), 1621.98 (0), 1641.91 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WI0 (ecoli-dige4.5-6.5)
 pI: 4.94 Mw: 52681
 %vol: 0.98246   %od: 1.13453
 ================
 *TIG_ECOLI*
  accession n°: P0A850

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)ELPELTAEFIK(R);; $m/Z=(R)NVALEEQAVEAVLAK(A);; $m/Z=(R)VVVGLLLGEVIR(T);; $m/Z=(K)ANDIDVPAALIDSEIDVLRR(Q);; $m/Z=(R)FGVEDGSVEGLRAEVR(K);; $m/Z=(R)NFIDAIIKEK(I);; $m/Z=(R)NFIDAIIK(E);; $m/Z=(R)VTITIAADSIETAVK(S) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 856.5 (0), 862.44 (0), 919.46 (0), 933.43 (0), 944.45 (0),
  987.5 (0), 1133.46 (0), 1149.46 (0), 1171.59 (0), 1190.53 (0),
  1204.5 (0), 1218.44 (0), 1266.69 (0), 1445.66 (0), 1531.69 (0),
  1687.81 (0), 1719.72 (0), 1800.81 (0), 1886.72 (0), 2038.87 (0),
  2194.95 (0), 2438.98 (0), 2623.96 (0), 2828.98 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WD7 (ecoli-dige4.5-6.5)
 pI: 5.24 Mw: 79447
 %vol: 0.0759014   %od: 0.0288349
 ================
 *FEPA_ECOLI*
  accession n°: P05825

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TNFSLTGPLGDEFSFR(L);; $m/Z=(R)IPEGLAGGTEGKFNEK(A);; $m/Z=(K)GQPAVGPETK(E);; $m/Z=(K)NVSLTGGVDNLFDKR(L);; $m/Z=(R)YGNGAAGGVVNIITK(K) }
[Click to access protein entry]
 Spot: 2D-001WCG (ecoli-dige4.5-6.5)
 pI: 5.47 Mw: 86507
 %vol: 0.130991   %od: 0.0746195
 ================
 *CATE_ECOLI*
  accession n°: P21179

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1031.49 (0), 1072.44 (0), 1228.55 (0), 1292.71 (0), 1452.7 (0),
  1509.73 (0), 1589.8 (0) }
[Click to access protein entry]
 Spot: 2D-001WLW (ecoli-dige4.5-6.5)
 pI: 5.03 Mw: 42217
 %vol: 0.180971   %od: 0.14503
 ================
 *ENGD_ECOLI*
  accession n°: P0ABU2

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1418.75 (0), 1467.79 (0), 1562.77 (0), 1750.87 (0), 1892.85 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WQ5 (ecoli-dige4.5-6.5)
 pI: 5.03 Mw: 33449
 %vol: 0.144564   %od: 0.148224
 ================
 *FABD_ECOLI*
  accession n°: P0AAI9

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)ITFNAPTVPVVNNVDVK(C);; $m/Z=(K)ACEEAAEGQVVSPVNFNSPGQVVIAGHK(E) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 887.52 (0), 930.39 (0), 1276.54 (0), 1589.6 (0), 1826.77 (0),
  1918.83 (0), 2893.99 (0), 3478.03 (0) }
[Click to access protein entry]
 Spot: 2D-001WR7 (ecoli-dige4.5-6.5)
 pI: 5.38 Mw: 32000
 %vol: 0.167771   %od: 0.23636
 ================
 *KHSE_ECOLI*
  accession n°: P00547

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)QAVAEIGAVASGISGSGPTLFALCDKPETAQR(V) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 931.48 (0), 1145.51 (0), 1159.51 (0), 1201.57 (0), 1217.56 (0),
  1247.54 (0), 1334.6 (0), 1350.59 (0), 1720.77 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WUW (ecoli-dige4.5-6.5)
 pI: 4.93 Mw: 23247
 %vol: 0.0820757   %od: 0.114821
 ================
 *ALKH_ECOLI*
  accession n°: P0A955

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1034.47 (0), 1136.55 (0), 1357.75 (0), 1439.67 (0), 1910.08 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WDV (ecoli-dige4.5-6.5)
 pI: 4.92 Mw: 74532
 %vol: 0.24644   %od: 0.14195
 ================
 *DNAK_ECOLI*
  accession n°: P0A6Y8

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 952.45 (0), 960.45 (0), 1050.48 (0), 1149.62 (0), 1206.59 (0),
  1299.71 (0), 1395.75 (0), 1427.84 (0), 1544.84 (0), 1598.83 (0),
  1659.89 (0), 2190.12 (0) }
[Click to access protein entry]
 Spot: 2D-001WFW (ecoli-dige4.5-6.5)
 pI: 4.96 Mw: 59987
 %vol: 0.979053   %od: 1.81957
 ================
 *CH60_ECOLI*
  accession n°: P0A6F5

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)LADLRGQNEDQNVGIK(V);; $m/Z=(R)AAVEEGVVAGGGVALIR(V);; $m/Z=(R)VVINKDTTTIIDGVGEEAAIQGR(V);; $m/Z=(K)AVTAAVEELK(A);; $m/Z=(R)GIDKAVTAAVEELK(A);; $m/Z=(K)SFGAPTITK(D) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 875.39 (0), 1011.46 (0), 1201.53 (0), 1238.52 (0), 1443.6 (0),
  1454.51 (0), 1567.73 (0), 1589.69 (0), 1711.6 (0), 1760.69 (0),
  1769.71 (0), 1845.72 (0), 1956.77 (0), 2398.94 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WUA (ecoli-dige4.5-6.5)
 pI: 4.84 Mw: 24436
 %vol: 0.0518429   %od: 0.061707
 ================
 *FKBB_ECOLI*
  accession n°: P0A9L3

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LIDGTVFDSSVAR(G) }

  ================
 *YNIC_ECOLI*
  accession n: P77247

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AISLVEETRPLLPGVR(E) }
[Click to access protein entry]
 Spot: 2D-001WR8 (ecoli-dige4.5-6.5)
 pI: 5.78 Mw: 32101
 %vol: 0.068769   %od: 0.0529362
 ================
 *EFG_ECOLI*
  accession n°: P0A6M8

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)EFNVEANVGKPQVAYR(E);; $m/Z=(K)GQESEVTGVK(I);; $m/Z=(K)GGVIPGEYIPAVDK(G) }

  ================
 *RSUA_ECOLI*
  accession n: P0AA43

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)DLTKPAVLEVITPTQVR(L);; $m/Z=(K)TYLVTLESPVADDTAEQFAK(G);; $m/Z=(R)GNRVTVDGEIVR(N);; $m/Z=(K)FIAQQLGVSR(A) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 987.5 (0), 1118.57 (0), 1314.65 (0), 1474.77 (0), 1880.05 (0),
  2198.05 (0), 2327.14 (0), 2785.52 (0), 2828.44 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WMV (ecoli-dige4.5-6.5)
 pI: 5.09 Mw: 39439
 %vol: 0.275076   %od: 0.242951
 ================
 *LIVK_ECOLI*
  accession n°: P04816

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)TGSDEPLALVK(D);; $m/Z=(K)AANANVVFFDGITAGEKDFSALIAR(L);; $m/Z=(R)TAGLDSSQGPTAAK(Y) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 892.43 (0), 1021.42 (0), 1129.47 (0), 1246.61 (0), 1303.58 (0),
  1480.59 (0), 1802.74 (0), 1811.8 (0), 2027.78 (0), 2507.94 (0),
  2597.02 (0) }
[Click to access protein entry]
 Spot: 2D-001WDY (ecoli-dige4.5-6.5)
 pI: 4.91 Mw: 74850
 %vol: 0.0902194   %od: 0.0241307
 ================
 *DNAK_ECOLI*
  accession n°: P0A6Y8

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)IINEPTAAALAYGLDKGTGNR(T);; $m/Z=(K)TAEDYLGEPVTEAVITVPAYFNDAQR }
[Click to access protein entry]
 Spot: 2D-001WMD (ecoli-dige4.5-6.5)
 pI: 5.75 Mw: 41241
 %vol: 0.145788   %od: 0.105487
 ================
 *TRPB_ECOLI*
  accession n°: P0A879

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ENPDKEQLLVVNLSGR(G);; $m/Z=(K)DACNEALR(D);; $m/Z=(R)QLEEAFVSAQKDPEFQAQFNDLLK(N) }

  ================
 *ARGD_ECOLI*
  accession n: P18335

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)ATFDEVILPIYAPAEFIPVK(G);; $m/Z=(R)SLFTVSVGGQPK(Y);; $m/Z=(K)IDQQYDVFSDIR(G);; $m/Z=(K)LIEATFAER(V);; $m/Z=(-)AIEQTAITR(A);; $m/Z=(R)ATFDEVILPIYAPAEFIPVKGQGSR(I) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 886.4 (0), 1049.52 (0), 1145.57 (0), 1177.61 (0), 1219.61 (0),
  1282.65 (0), 1498.71 (0), 2233.2 (0), 2718.52 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WS5 (ecoli-dige4.5-6.5)
 pI: 5.37 Mw: 27969
 %vol: 0.128649   %od: 0.208737
 ================
 *DAPB_ECOLI*
  accession n°: P04036

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 970.41 (0), 982.47 (0), 1117.66 (0), 1398.74 (0), 1618.93 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WIX (ecoli-dige4.5-6.5)
 pI: 5.93 Mw: 50340
 %vol: 0.112894   %od: 0.0682248
 ================
 *LEUC_ECOLI*
  accession n°: P0A6A6

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1018.59 (0), 1031.55 (0), 1049.57 (0), 1140.61 (0), 1574.99 (0),
  1670.77 (0), 1703.08 (0), 1805.98 (0), 1838.02 (0), 2116.16 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WJS (ecoli-dige4.5-6.5)
 pI: 5.06 Mw: 47667
 %vol: 0.120931   %od: 0.0825284
 ================
 *PUR2_ECOLI*
  accession n°: P15640

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1373.69 (0), 1419.74 (0), 1446.83 (0), 1699.88 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WTS (ecoli-dige4.5-6.5)
 pI: 5.40 Mw: 25098
 %vol: 0.100918   %od: 0.17907
 ================
 *DEOD_ECOLI*
  accession n°: P0ABP8

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)YIAETFLEDAREVNNVR(G);; $m/Z=(K)ELITDFGVK(K);; $m/Z=(R)GMLGFTGTYK(G);; $m/Z=(K)YIAETFLEDAR(E) }
[Click to access protein entry]
 Spot: 2D-001WN2 (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 38773
 %vol: 1.47018   %od: 2.45966
 ================
 *LIVJ_ECOLI*
  accession n°: P0AD96

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)GNANVVFFDGITAGEKDFSTLVAR(L);; $m/Z=(K)QAVAVANKVVNDGIK(Y);; $m/Z=(R)TTGLDSDQGPTAAK(Y) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 856.46 (0), 862.47 (0), 908.39 (0), 983.25 (0), 1021.37 (0),
  1361.44 (0), 1525.61 (0), 1784.67 (0), 1797.7 (0), 2069.68 (0),
  2400.74 (0), 2483.56 (0), 2527.84 (0), 2756.02 (0), 3144.1 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WP1 (ecoli-dige4.5-6.5)
 pI: 5.10 Mw: 35000
 %vol: 0.217165   %od: 0.284285
 ================
 *TALB_ECOLI*
  accession n°: P0A870

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 939.58 (0), 1031.54 (0), 1047.56 (0), 1203.63 (0), 1237.62 (0),
  1402.76 (0), 1459.75 (0), 1582.77 (0), 1699.86 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WJG (ecoli-dige4.5-6.5)
 pI: 5.07 Mw: 48837
 %vol: 0.169261   %od: 0.126064
 ================
 *HISX_ECOLI*
  accession n°: P06988

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1130.58 (0), 1188.64 (0), 1232.65 (0), 1350.77 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WQ7 (ecoli-dige4.5-6.5)
 pI: 5.65 Mw: 33203
 %vol: 0.253732   %od: 0.353835
 ================
 *PROX_ECOLI*
  accession n°: P0AFM2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DVVWLQVPFSALPGDK(N);; $m/Z=(K)ASEGDIQGHVDGWIK(A);; $m/Z=(K)GITVNPVQSTITEETFQTLLVSR(A);; $m/Z=(R)EGVFVNGAAQGYLIDK(K);; $m/Z=(R)EGVFVNGAAQGYLIDKK(T);; $m/Z=(K)LFDTNGDGK(A) }
[Click to access protein entry]
 Spot: 2D-001WMA (ecoli-dige4.5-6.5)
 pI: 5.79 Mw: 41417
 %vol: 0.115129   %od: 0.102482
 ================
 *ACKA_ECOLI*
  accession n°: P0A6A3

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)LVLVLNCGSSSLK(F);; $m/Z=(K)EGTRPAVVIPTNEELVIAQDASR(L);; $m/Z=(R)YVEDNYATK(E);; $m/Z=(K)FAIIDAVNGEEYLSGLAECFHLPEAR(I);; $m/Z=(K)YTSSVVIDESVIQGIK(D);; $m/Z=(K)ESGLLGLTEVTSDCR(Y) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1102.42 (0), 1370.68 (0), 1389.74 (0), 1636.81 (0), 1642.87 (0),
  1737.91 (0), 1866.91 (0), 2314.24 (0), 2465.31 (0), 2921.45 (0),
  4011.37 (0) }

  ================
 *CARA_ECOLI*
  accession n: P0A6F1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)FLETDIPVFGICLGHQLLALASGAK(T);; $m/Z=(K)SLFDGTLQGIHR(T);; $m/Z=(R)LTIVPAQTSAEDVLK(M);; $m/Z=(R)DLPLIASNFR(N) }
[Click to access protein entry]
 Spot: 2D-001WHC (ecoli-dige4.5-6.5)
 pI: 5.82 Mw: 55131
 %vol: 0.0998534   %od: 0.0647856
 ================
 *OPPA_ECOLI*
  accession n°: P23843

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1030.54 (0), 1094.53 (0), 1425.73 (0), 1629.88 (0), 2017.91 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WVT (ecoli-dige4.5-6.5)
 pI: 5.17 Mw: 21096
 %vol: 0.12668   %od: 0.187968
 ================
 *YCEI_ECOLI*
  accession n°: P0A8X2

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)LIGQGDDPWGGKR(A);; $m/Z=(R)SADFLNTAK(Y);; $m/Z=(K)TDLGPASQEVDLIISVEGVQQK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 877.43 (0), 964.39 (0), 1204.45 (0), 1321.4 (0), 1329.47 (0),
  1398.53 (0), 1457.55 (0), 1560.6 (0), 1712.63 (0), 1870.68 (0),
  1917.53 (0), 2325.81 (0), 2613.86 (0), 2741.94 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WK8 (ecoli-dige4.5-6.5)
 pI: 5.51 Mw: 46525
 %vol: 0.0515234   %od: 0.0187641
 ================
 *EFG_ECOLI*
  accession n°: P0A6M8

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)EFNVEANVGKPQVAYR(E) }
[Click to access protein entry]
 Spot: 2D-001WI9 (ecoli-dige4.5-6.5)
 pI: 5.71 Mw: 52681
 %vol: 0.976764   %od: 1.02815
 ================
 *OPPA_ECOLI*
  accession n°: P23843

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 937.48 (0), 949.41 (0), 1007.52 (0), 1050.52 (0), 1325.63 (0),
  1327.76 (0), 1526.77 (0), 1890.89 (0) }
[Click to access protein entry]
 Spot: 2D-001WWG (ecoli-dige4.5-6.5)
 pI: 5.53 Mw: 19289
 %vol: 0.0933597   %od: 0.145196
 ================
 *ATPF_ECOLI*
  accession n°: P0ABA0

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1059.57 (0), 1131.53 (0), 1169.63 (0), 1313.66 (0), 1387.71 (0),
  1427.74 (0), 1469.79 (0), 1512.8 (0), 1555.83 (0), 1716.84 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WE2 (ecoli-dige4.5-6.5)
 pI: 4.94 Mw: 73587
 %vol: 0.898574   %od: 0.823862
 ================
 *DNAK_ECOLI*
  accession n°: P0A6Y8

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 925.49 (0), 952.45 (0), 960.43 (0), 1002.47 (0), 1050.47 (0),
  1061.45 (0), 1149.66 (0), 1177.59 (0), 1206.62 (0), 1267.71 (0),
  1277.68 (0), 1286.73 (0), 1290.62 (0), 1299.7 (0), 1395.84 (0),
  1427.82 (0), 1509.7 (0), 1544.9 (0), 1598.89 (0), 1659.93 (0),
  2190.14 (0) }
[Click to access protein entry]
 Spot: 2D-001WOI (ecoli-dige4.5-6.5)
 pI: 5.43 Mw: 36348
 %vol: 0.152388   %od: 0.15293
 ================
 *K6PF1_ECOLI*
  accession n°: P0A796

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 865.47 (0), 949.45 (0), 1100.53 (0), 1715.93 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WJL (ecoli-dige4.5-6.5)
 pI: 5.81 Mw: 48395
 %vol: 0.0342248   %od: 0.0245734
 ================
 *TNAA_ECOLI*
  accession n°: P0A853

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AVEIGSFLLGRDPK(T);; $m/Z=(R)AVEIGSFLLGR(D);; $m/Z=(R)FAENAYFIK(Q);; $m/Z=(R)GAEQIYIPVLIK(K) }
[Click to access protein entry]
 Spot: 2D-001WRR (ecoli-dige4.5-6.5)
 pI: 5.32 Mw: 29821
 %vol: 0.0553026   %od: 0.0566986
 ================
 *YDBC_ECOLI*
  accession n°: P25906

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)SPNILLIPGTSSVAHLR(E);; $m/Z=(R)EALYPYSDDLTIVTK(I) }

  ================
 *OTSB_ECOLI*
  accession n: P31678

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TPVFLGDDLTDESGFAVVNR(L) }
[Click to access protein entry]
 Spot: 2D-001WQG (ecoli-dige4.5-6.5)
 pI: 5.40 Mw: 32959
 %vol: 0.0855354   %od: 0.0916219
 ================
 *FABI_ECOLI*
  accession n°: P0AEK4

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ILVTGVASK(L);; $m/Z=(R)VNAISAGPIR(T);; $m/Z=(R)EGAELAFTYQNDKLK(G) }

  ================
 *HIS1_ECOLI*
  accession n: P60757

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)ALGASSILVLPIEK(M);; $m/Z=(R)LDEVIALLPGAERPTILPLAGDQQR(V);; $m/Z=(K)INLHTQR(L) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 859.45 (0), 881.47 (0), 884.49 (0), 907.44 (0), 928.4 (0),
  975.5 (0), 980.42 (0), 1142.59 (0), 1298.68 (0), 1410.79 (0),
  1665.8 (0), 2239.2 (0), 2685.52 (0) }
[Click to access protein entry]
 Spot: 2D-001WHR (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 53162
 %vol: 0.155954   %od: 0.0861832
 ================
 *GLNA_ECOLI*
  accession n°: P0A9C5

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AGGVFTDEAIDAYIALR(R);; $m/Z=(K)GGYFPVPPVDSAQDIR(S);; $m/Z=(K)RAEDYLR(S) }
[Click to access protein entry]
 Spot: 2D-001WIT (ecoli-dige4.5-6.5)
 pI: 4.69 Mw: 50800
 %vol: 0.0436459   %od: 0.0238448
 ================
 *SYN_ECOLI*
  accession n°: P0A8M0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VSTLDLENLPR(N) }

  ================
 *DHAM_ECOLI*
  accession n: P37349

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LIAKGPEAEEALIAFR(Q);; $m/Z=(R)QLAEDNFGETEEVAPPTLRPVPPVSGK(A);; $m/Z=(K)STLTVEEEQDRLR(Q) }
[Click to access protein entry]
 Spot: 2D-001WWJ (ecoli-dige4.5-6.5)
 pI: 4.83 Mw: 19048
 %vol: 0.0690883   %od: 0.0793096
 ================
 *RS2_ECOLI*
  accession n°: P0A7V0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LENSLGGIK(D) }
[Click to access protein entry]
 Spot: 2D-001WGG (ecoli-dige4.5-6.5)
 pI: 5.61 Mw: 58475
 %vol: 0.143659   %od: 0.104809
 ================
 *PYRG_ECOLI*
  accession n°: P0A7E5

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 901.46 (0), 919.46 (0), 965.49 (0), 1111.58 (0), 1175.63 (0),
  1190.64 (0), 1434.84 (0), 1701.89 (0) }
[Click to access protein entry]
 Spot: 2D-001WKJ (ecoli-dige4.5-6.5)
 pI: 6.00 Mw: 45000
 %vol: 0.125296   %od: 0.0970718
 ================
 *GLYA_ECOLI*
  accession n°: P0A825

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)NSVPNDPK(S);; $m/Z=(K)VVSGGTDNHLFLVDLVDK(N);; $m/Z=(K)GGSEELYK(S);; $m/Z=(K)LYNIVPYGIDATGHIDYADLEK(Q) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 870.43 (0), 882.36 (0), 963.46 (0), 1010.45 (0), 1040.43 (0),
  1093.49 (0), 1927.84 (0), 2015.8 (0), 2162.82 (0), 2318.94 (0),
  2441.07 (0) }
[Click to access protein entry]
 Spot: 2D-001WXC (ecoli-dige4.5-6.5)
 pI: 5.70 Mw: 16000
 %vol: 0.122422   %od: 0.233556
 ================
 *YGAU_ECOLI*
  accession n°: P0ADE6

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SGDTLSAISK(Q);; $m/Z=(K)ATVTGDGLSQEAKEK(I) }
[Click to access protein entry]
 Spot: 2D-001WRY (ecoli-dige4.5-6.5)
 pI: 5.92 Mw: 29066
 %vol: 0.0529605   %od: 0.0322045
 ================
 *RBSB_ECOLI*
  accession n°: P02925

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)LAATIAQLPDQIGAK(G);; $m/Z=(K)VIELQGIAGTSAAR(E);; $m/Z=(K)GEVVSHIASDNVLGGK(I);; $m/Z=(K)ILLINPTDSDAVGNAVK(M);; $m/Z=(K)ELANVQDLTVR(G);; $m/Z=(K)EADKLGYNLVVLDSQNNPAK(E);; $m/Z=(K)FNVLASQPADFDR(I) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 850.47 (0), 978.49 (0), 1242.5 (0), 1257.63 (0), 1385.75 (0),
  1479.74 (0), 1509.83 (0), 1527.77 (0), 1581.79 (0), 1739.93 (0),
  2188.13 (0) }
[Click to access protein entry]
 Spot: 2D-001WXP (ecoli-dige4.5-6.5)
 pI: 5.15 Mw: 10500
 %vol: 0.273053   %od: 0.35207
 ================
 *CH10_ECOLI*
  accession n°: P0A6F9

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GEVLAVGNGR(I);; $m/Z=(K)SAGGIVLTGSAAAK(S);; $m/Z=(K)STRGEVLAVGNGR(I);; $m/Z=(K)VGDIVIFNDGYGVK(S) }
[Click to access protein entry]
 Spot: 2D-001WO5 (ecoli-dige4.5-6.5)
 pI: 5.36 Mw: 37000
 %vol: 0.105123   %od: 0.0810527
 ================
 *OMPT_ECOLI*
  accession n°: P09169

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)NGAGIENYNFITTAGLK(Y);; $m/Z=(R)GGSYIYSSEEGFRDDIGSFPNGER(A) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 875.43 (0), 890.47 (0), 993.46 (0), 1003.51 (0), 1093.51 (0),
  1121.55 (0), 1224.56 (0), 1257.6 (0), 1261.61 (0), 1278.61 (0),
  1305.58 (0), 1532.77 (0), 1782.86 (0), 1929.8 (0), 2240.92 (0),
  2464.16 (0), 2515.25 (0), 2693.13 (0) }
[Click to access protein entry]
 Spot: 2D-001WK2 (ecoli-dige4.5-6.5)
 pI: 5.27 Mw: 46667
 %vol: 0.61578   %od: 0.632475
 ================
 *THRC_ECOLI*
  accession n°: P00934

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ADLPLLSHNLPADFAALR(K);; $m/Z=(K)FKESVEAILGETLDLPK(E) }

  ================
 *ASSY_ECOLI*
  accession n: P0A6E4

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)NLDITDTR(E);; $m/Z=(R)GNDYSILNTVSENLTYKPER(L);; $m/Z=(R)LLTGIHNEDTIEQYHAHGR(Q);; $m/Z=(K)IPAEEVTVR(F);; $m/Z=(K)GAVPYAYTANLGQPDEEDYDAIPR(R);; $m/Z=(R)YGLLTNAELQIYKPWLDTDFIDELGGR;; $m/Z=(K)FWDESVKIPAEEVTVR(F);; $m/Z=(K)TGLLSSSAASGVPQVENLENK(G) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 910.4 (0), 947.44 (0), 955.49 (0), 1013.52 (0), 1094.42 (0),
  1167.51 (0), 1266.57 (0), 1267.55 (0), 1296.59 (0), 1356.59 (0),
  1701.84 (0), 1865.69 (0), 1903.88 (0), 1978.97 (0), 2203.99 (0),
  2286.02 (0), 2313.03 (0), 2469.11 (0), 2625.04 (0), 2781.13 (0),
  2881.17 (0), 3140.35 (0), 3378.45 (0), 3506.42 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WIK (ecoli-dige4.5-6.5)
 pI: 5.29 Mw: 51264
 %vol: 0.452798   %od: 0.351107
 ================
 *ILVC_ECOLI*
  accession n°: P05793

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AIPEGAVDNGQLRDVNEAIR(S);; $m/Z=(-)ANYFNTLNLR(Q);; $m/Z=(R)DSGLDISYALR(K);; $m/Z=(K)DGAALGYSHGFNIVEVGEQIRK(D);; $m/Z=(R)GFGVPTLIAVHPENDPK(G);; $m/Z=(R)AGVLESSFVAEVK(S);; $m/Z=(K)LIQFGWETITEALK(Q);; $m/Z=(K)TAFETAPQYEGK(I);; $m/Z=(R)SHAIEQVGK(K) }
[Click to access protein entry]
 Spot: 2D-001WJ2 (ecoli-dige4.5-6.5)
 pI: 5.62 Mw: 50340
 %vol: 0.0922952   %od: 0.0543672
 ================
 *PEPQ_ECOLI*
  accession n°: P21165

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)ADGIGSLLPAAR(G);; $m/Z=(R)ALQLGIEASNINPK(G);; $m/Z=(R)GNIGYIGPVPER(A) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1140.57 (0), 1152.51 (0), 1200.66 (0), 1271.62 (0), 1298.58 (0),
  1467.72 (0), 1819.79 (0), 2046.96 (0), 2132.11 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WG2 (ecoli-dige4.5-6.5)
 pI: 4.98 Mw: 60758
 %vol: 0.154411   %od: 0.0354627
 ================
 *CH60_ECOLI*
  accession n°: P0A6F5

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 921.49 (0), 1030.57 (0), 1201.62 (0), 1215.69 (0), 1454.67 (0),
  1567.9 (0), 1760.93 (0), 1845.94 (0), 2042.94 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WWC (ecoli-dige4.5-6.5)
 pI: 5.08 Mw: 19656
 %vol: 0.116726   %od: 0.157747
 ================
 *DKSA_ECOLI*
  accession n°: P0ABS1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AAQEEEFSLELR(N) }
[Click to access protein entry]
 Spot: 2D-001WVX (ecoli-dige4.5-6.5)
 pI: 4.88 Mw: 20670
 %vol: 0.0373121   %od: 0.0684098
 ================
 *YEBR_ECOLI*
  accession n°: P76270

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)FTDEDEQGLRQLVAQLEK(V);; $m/Z=(R)QLVAQLEK(V);; $m/Z=(K)NQIIGVLDIDSTVFGR(F);; $m/Z=(R)FTDEDEQGLR(Q) }
[Click to access protein entry]
 Spot: 2D-001WNW (ecoli-dige4.5-6.5)
 pI: 4.56 Mw: 37316
 %vol: 0.030286   %od: 0.0135571
 ================
 *OMPF_ECOLI*
  accession n°: P02931

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)NSNFFGLVDGLNFAVQYLGK(N);; $m/Z=(R)NSNFFGLVDGLNFAVQYLGKNER(D);; $m/Z=(K)YDANNIYLAANYGETR(N);; $m/Z=(R)LAFAGLKYADVGSFDYGR(N) }
[Click to access protein entry]
 Spot: 2D-001WRI (ecoli-dige4.5-6.5)
 pI: 4.52 Mw: 30891
 %vol: 0.0388022   %od: 0.0608694
 ================
 *ARCA_ECOLI*
  accession n°: P0A9Q1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)SLIGPDGEQYKLPR(S) }

  ================
 *GPH_ECOLI*
  accession n: P32662

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GLPLGLVTNKPTPFVAPLLEALDIAK(Y) }
[Click to access protein entry]
 Spot: 2D-001WKS (ecoli-dige4.5-6.5)
 pI: 5.15 Mw: 44053
 %vol: 1.17338   %od: 1.32383
 ================
 *IDH_ECOLI*
  accession n°: P08200

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1124.73 (0), 1139.57 (0), 1206.66 (0), 1357.68 (0), 1373.63 (0),
  1646.87 (0), 1662.91 (0), 1674.96 (0), 2045.85 (0), 2085.91 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WWQ (ecoli-dige4.5-6.5)
 pI: 4.50 Mw: 18143
 %vol: 0.0481172   %od: 0.0905361
 ================
 *DCRB_ECOLI*
  accession n°: P0AEE1

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)SRDPQLQVVTNK(A) }
[Click to access protein entry]
 Spot: 2D-001WSL (ecoli-dige4.5-6.5)
 pI: 5.86 Mw: 27000
 %vol: 0.295834   %od: 0.388252
 ================
 *GPMA_ECOLI*
  accession n°: P62707

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 985.4 (0), 1100.53 (0), 1150.63 (0), 1308.56 (0), 1315.65 (0),
  1327.57 (0), 1356.51 (0), 1384.57 (0), 1459.6 (0), 1467.65 (0),
  1500.76 (0), 1570.79 (0), 1729.78 (0), 1911.81 (0), 2028.01 (0),
  2109.91 (0), 2490.12 (0) }
[Click to access protein entry]
 Spot: 2D-001WMS (ecoli-dige4.5-6.5)
 pI: 5.18 Mw: 39439
 %vol: 0.189647   %od: 0.205034
 ================
 *LIVJ_ECOLI*
  accession n°: P0AD96

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)NYDQVPANKPIVDAIK(A);; $m/Z=(R)TTGLDSDQGPTAAK(Y);; $m/Z=(K)GNANVVFFDGITAGEKDFSTLVAR(L) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 858.48 (0), 862.5 (0), 891.45 (0), 908.42 (0), 983.36 (0),
  1021.49 (0), 1361.65 (0), 1784.92 (0), 1797.96 (0), 2528.3 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WNK (ecoli-dige4.5-6.5)
 pI: 5.45 Mw: 37876
 %vol: 0.198483   %od: 0.187869
 ================
 *ASNA_ECOLI*
  accession n°: P00963

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VKALPDAQFEVVHSLAK(W);; $m/Z=(R)LGLIEVQAPILSR(V);; $m/Z=(K)STVEAIWAGIK(A);; $m/Z=(K)ALPDAQFEVVHSLAK(W);; $m/Z=(K)DLGAVFLVGIGGK(L) }
[Click to access protein entry]
 Spot: 2D-001WQU (ecoli-dige4.5-6.5)
 pI: 5.41 Mw: 32544
 %vol: 0.0852693   %od: 0.0660112
 ================
 *RMLA1_ECOLI*
  accession n°: P37744

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GFIDVEQVR(K);; $m/Z=(R)FQQLLGDGSQWGLNLQYK(V);; $m/Z=(R)GELEITDINRIYLEQGR(L);; $m/Z=(R)IYLEQGR(L);; $m/Z=(R)YGVVEFDKNGTAISLEEKPLEPK(S);; $m/Z=(K)GIILAGGSGTR(L);; $m/Z=(R)GYAWLDTGTHQSLIEASNFIATIEER }
[Click to access protein entry]
 Spot: 2D-001WIG (ecoli-dige4.5-6.5)
 pI: 5.82 Mw: 52204
 %vol: 0.280718   %od: 0.132768
 ================
 *ATPA_ECOLI*
  accession n°: P0ABB0

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1062.6 (0), 1074.55 (0), 1183.68 (0), 1270.66 (0), 1298.8 (0),
  1349.69 (0), 1537.81 (0), 1551.77 (0), 1568.83 (0), 1722.89 (0),
  1856.91 (0), 1925.92 (0), 1941.92 (0), 1984.99 (0), 2125.09 (0),
  2150.1 (0) }
[Click to access protein entry]
 Spot: 2D-001WLU (ecoli-dige4.5-6.5)
 pI: 5.40 Mw: 42307
 %vol: 0.607796   %od: 0.353011
 ================
 *EFTU2_ECOLI*
  accession n°: P0CE48

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)QVGVPYIIVFLNK(C);; $m/Z=(K)ILELAGFLDSYIPEPER(A) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1027.55 (0), 1073.54 (0), 1171.57 (0), 1218.55 (0), 1233.56 (0),
  1290.57 (0), 1303.7 (0), 1331.57 (0), 1376.58 (0), 1489.82 (0),
  1603.77 (0), 1657.87 (0), 1710.92 (0), 1728.88 (0), 1768.82 (0),
  1795.9 (0), 1803.86 (0), 1812.9 (0), 1962.04 (0), 1964.99 (0),
  2117.16 (0), 2174.2 (0) }
[Click to access protein entry]
 Spot: 2D-001WRB (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 32000
 %vol: 0.126786   %od: 0.11687
 ================
 *SPEE_ECOLI*
  accession n°: P09158

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)TDHQDLIIFENAAFGR(V);; $m/Z=(R)CLNPGGIFVAQNGVCFLQQEEAIDSHR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1167.6 (0), 1408.74 (0), 1418.75 (0), 1746.77 (0), 1846.93 (0),
  2021.96 (0), 2850.44 (0), 3059.5 (0), 3187.64 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WPB (ecoli-dige4.5-6.5)
 pI: 5.14 Mw: 34596
 %vol: 0.11678   %od: 0.174261
 ================
 *EFTS_ECOLI*
  accession n°: P0A6P1

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)AQFEEER(V) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 908.34 (0), 928.47 (0), 1069.4 (0), 1084.53 (0), 1272.52 (0),
  1742.73 (0), 1898.8 (0), 2268.91 (0) }
[Click to access protein entry]
 Spot: 2D-001WH8 (ecoli-dige4.5-6.5)
 pI: 5.99 Mw: 55298
 %vol: 0.0880903   %od: 0.0562727
 ================
 *IMDH_ECOLI*
  accession n°: P0ADG7

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)IVTGVGVPQITAVADAVEALEGTGIPVIADGGIR(F);; $m/Z=(R)NGFAGYPVVTEENELVGIITGR(D) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 850.49 (0), 887.43 (0), 969.5 (0), 1076.48 (0), 1158.48 (0),
  1217.6 (0), 1257.58 (0), 1302.61 (0), 1637.93 (0), 1786.92 (0),
  1891.99 (0), 1986.09 (0), 2109.03 (0), 2179.16 (0), 2235.19 (0),
  2757.45 (0), 3209.68 (0), 3258.79 (0) }
[Click to access protein entry]
 Spot: 2D-001WX9 (ecoli-dige4.5-6.5)
 pI: 5.25 Mw: 16126
 %vol: 0.170272   %od: 0.30464
 ================
 *OMPX_ECOLI*
  accession n°: P0A917

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)FQTTEYPTYK(H);; $m/Z=(R)INDWASIYGVVGVGYGK(F);; $m/Z=(K)NQYYGITAGPAYR(I);; $m/Z=(R)TASSGDYNKNQYYGITAGPAYR(I);; $m/Z=(K)YRYEEDNSPLGVIGSFTYTEK(S);; $m/Z=(R)SVDVGTWIAGVGYR(F) }
[Click to access protein entry]
 Spot: 2D-001WPI (ecoli-dige4.5-6.5)
 pI: 5.83 Mw: 34342
 %vol: 0.408568   %od: 0.524188
 ================
 *CYSK_ECOLI*
  accession n°: P0ABK5

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)AEEIVASNPEK(Y);; $m/Z=(K)ALGANLVLTEGAK(G);; $m/Z=(R)GVLKPGVELVEPTSGNTGIALAYVAAAR(G);; $m/Z=(K)NIVVILPSSGER(Y);; $m/Z=(R)YLSTALFADLFTEK(E);; $m/Z=(K)LQEDESFTNK(N);; $m/Z=(K)IQGIGAGFIPANLDLK(L);; $m/Z=(K)YLLLQQFSNPANPEIHEK(T) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1186.5 (0), 1210.48 (0), 1256.64 (0), 1283.67 (0), 1403.64 (0),
  1473.71 (0), 1618.73 (0), 1626.8 (0), 1811.86 (0), 1928.96 (0),
  2116.95 (0), 2140.97 (0), 2257.1 (0), 2753.31 (0), 3182.41 (0),
  3235.26 (0) }
[Click to access protein entry]
 Spot: 2D-001WOM (ecoli-dige4.5-6.5)
 pI: 5.94 Mw: 36106
 %vol: 0.0318828   %od: 0.0238426
 ================
 *G3P1_ECOLI*
  accession n°: P0A9B2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GASQNIIPSSTGAAK(A);; $m/Z=(K)AGIALNDNFVK(L);; $m/Z=(K)AATYEQIK(A) }
[Click to access protein entry]
 Spot: 2D-001WOQ (ecoli-dige4.5-6.5)
 pI: 5.91 Mw: 35787
 %vol: 0.0324683   %od: 0.0249106
 ================
 *GALE_ECOLI*
  accession n°: P09147

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)DSLAIFGNDYPTEDGTGVR(D);; $m/Z=(K)NFIFSSSATVYGDQPK(I);; $m/Z=(K)AVGESVQKPLEYYDNNVNGTLR(L) }
[Click to access protein entry]
 Spot: 2D-001WTM (ecoli-dige4.5-6.5)
 pI: 5.46 Mw: 25413
 %vol: 0.0820757   %od: 0.183709
 ================
 *NUOB_ECOLI*
  accession n°: P0AFC7

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)RPLSWVVGDQGVYR(A);; $m/Z=(K)QEIVTDPLEQEVNK(N) }
[Click to access protein entry]
 Spot: 2D-001WM3 (ecoli-dige4.5-6.5)
 pI: 5.82 Mw: 42128
 %vol: 0.0512572   %od: 0.0314685
 ================
 *CARA_ECOLI*
  accession n°: P0A6F1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)NTEDLSSYLKR(H);; $m/Z=(R)DLPLIASNFR(N) }

  ================
 *YAHK_ECOLI*
  accession n: P75691

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)YAPGDLVGVGCIVDSCK(H);; $m/Z=(K)ALGADEVVNSR(N) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 855.38 (0), 880.38 (0), 1011.46 (0), 1043.47 (0), 1082.47 (0),
  1130.48 (0), 1208.45 (0), 2056.79 (0) }
[Click to access protein entry]
 Spot: 2D-001WOJ (ecoli-dige4.5-6.5)
 pI: 4.94 Mw: 36106
 %vol: 0.165535   %od: 0.20949
 ================
 *HLDD_ECOLI*
  accession n°: P67910

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1015.52 (0), 1070.52 (0), 1088.59 (0), 1306.76 (0), 1540.87 (0),
  1571.95 (0), 1589.86 (0), 1693.04 (0), 1721.93 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WVA (ecoli-dige4.5-6.5)
 pI: 5.34 Mw: 22606
 %vol: 0.219348   %od: 0.37416
 ================
 *DSBA_ECOLI*
  accession n°: P0AEG4

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)SLVAQQEK(A);; $m/Z=(K)VTVPLFEGVQK(T) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 902.51 (0), 976.52 (0), 1035.52 (0), 1216.71 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WKQ (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 44524
 %vol: 0.234198   %od: 0.0784912
 ================
 *PURA_ECOLI*
  accession n°: P0A7D4

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 949.44 (0), 958.54 (0), 1137.55 (0), 1182.72 (0), 2081.18 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WS8 (ecoli-dige4.5-6.5)
 pI: 5.28 Mw: 27969
 %vol: 0.095755   %od: 0.0865323
 ================
 *HISJ_ECOLI*
  accession n°: P0AEU0

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1079.54 (0), 1123.64 (0), 1235.71 (0), 1330.76 (0), 1425.8 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WPG (ecoli-dige4.5-6.5)
 pI: 5.20 Mw: 34415
 %vol: 1.03303   %od: 1.44944
 ================
 *EFTS_ECOLI*
  accession n°: P0A6P1

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)IGENINIR(R);; $m/Z=(K)AQFEEER(V);; $m/Z=(K)DAGFQAFADK(V) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 860.39 (0), 908.33 (0), 916.45 (0), 928.47 (0), 1007.41 (0),
  1014.47 (0), 1069.39 (0), 1084.53 (0), 1142.55 (0), 1272.53 (0),
  1742.74 (0), 1859.75 (0), 1893.79 (0), 1898.81 (0), 1987.82 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WPU (ecoli-dige4.5-6.5)
 pI: 5.38 Mw: 33875
 %vol: 0.0535994   %od: 0.0321949
 ================
 *OMPA_ECOLI*
  accession n°: P0A910

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)HFTLKSDVLFNFNK(A);; $m/Z=(K)SDVLFNFNK(A);; $m/Z=(R)RAQSVVDYLISK(G);; $m/Z=(K)ATLKPEGQAALDQLYSQLSNLDPK(D);; $m/Z=(K)DGSVVVLGYTDRIGSDAYNQGLSER(R);; $m/Z=(R)IGSDAYNQGLSER(R);; $m/Z=(R)AQSVVDYLISK(G);; $m/Z=(K)LGYPITDDLDIYTR(L);; $m/Z=(K)AQGVQLTAK(L) }
[Click to access protein entry]
 Spot: 2D-001WQO (ecoli-dige4.5-6.5)
 pI: 5.47 Mw: 32751
 %vol: 0.445933   %od: 0.676505
 ================
 *ZNUA_ECOLI*
  accession n°: P39172

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ATAVAIHGK(L);; $m/Z=(K)ATCVFAEPQFRPAVVESVAR(G);; $m/Z=(K)QFGLTPLGHFTVNPEIQPGAQR(L);; $m/Z=(K)GYFVFHDAYGYFEK(Q);; $m/Z=(K)QVTIAQLEDVKPLLMK(S) }
[Click to access protein entry]
 Spot: 2D-001WJK (ecoli-dige4.5-6.5)
 pI: 4.99 Mw: 48103
 %vol: 0.588156   %od: 0.789567
 ================
 *ATPB_ECOLI*
  accession n°: P0ABB4

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)IVQVIGAVVDVEFPQDAVPR(V);; $m/Z=(R)FLSQPFFVAEVFTGSPGK(Y);; $m/Z=(R)GVQSILQR(Y);; $m/Z=(R)QIASLGIYPAVDPLDSTSR(Q);; $m/Z=(R)YTLAGTEVSALLGR(M);; $m/Z=(R)NIAIEHSGYSVFAGVGER(T);; $m/Z=(K)VGLFGGAGVGK(T);; $m/Z=(R)GLDVKDLEHPIEVPVGK(A);; $m/Z=(R)LVLEVQQQLGGGIVR(T);; $m/Z=(R)VYDALEVQNGNER(L) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 900.47 (0), 961.45 (0), 1094.53 (0), 1366.61 (0), 1450.66 (0),
  1506.59 (0), 1608.8 (0), 1823.74 (0), 1840.74 (0), 1905.75 (0),
  1957.81 (0), 2002.82 (0), 2150.96 (0), 2178.84 (0), 3816.37 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WOZ (ecoli-dige4.5-6.5)
 pI: 5.56 Mw: 35156
 %vol: 1.22805   %od: 1.36384
 ================
 *MDH_ECOLI*
  accession n°: P61889

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1008.56 (0), 1149.69 (0), 1234.67 (0), 1247.77 (0), 1258.69 (0),
  1276.73 (0), 1421.75 (0) }
[Click to access protein entry]
 Spot: 2D-001WVB (ecoli-dige4.5-6.5)
 pI: 5.94 Mw: 22606
 %vol: 0.0364602   %od: 0.0786197
 ================
 *G3P1_ECOLI*
  accession n°: P0A9B2

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 869.46 (0), 923.41 (0), 1108.57 (0), 1161.57 (0), 1224.67 (0),
  1292.66 (0), 1401.7 (0), 1495.84 (0), 1710.83 (0), 1866.07 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WSM (ecoli-dige4.5-6.5)
 pI: 4.90 Mw: 27000
 %vol: 0.180119   %od: 0.233952
 ================
 *METQ_ECOLI*
  accession n°: P28635

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)LKDGVGLLPTVLDVVENPK(N);; $m/Z=(K)DKYGLDVELVTENDYVLPNFALSK(G);; $m/Z=(K)LVAVGNTFVYPIAGYSK(K) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1264.61 (0), 1290.58 (0), 1724.79 (0), 1798.79 (0), 1861.68 (0),
  2005.93 (0), 2193.94 (0), 2324.93 (0), 2471.98 (0), 2566.06 (0),
  2634.02 (0), 2674.15 (0), 2742.11 (0) }
[Click to access protein entry]
 Spot: 2D-001WWL (ecoli-dige4.5-6.5)
 pI: 6.05 Mw: 18899
 %vol: 0.0422088   %od: 0.0196419
 ================
 *PURE_ECOLI*
  accession n°: P0AG18

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AGAANAALLAAQILATHDK(E) }
[Click to access protein entry]
 Spot: 2D-001WMR (ecoli-dige4.5-6.5)
 pI: 5.03 Mw: 39691
 %vol: 0.10837   %od: 0.0839752
 ================
 *RPOA_ECOLI*
  accession n°: P0A7Z4

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 850.44 (0), 956.48 (0), 970.41 (0), 1006.48 (0), 1063.47 (0),
  1142.51 (0), 1298.56 (0), 1331.62 (0), 1392.56 (0), 1421.6 (0),
  1426.6 (0), 1437.58 (0), 1456.69 (0), 1484.65 (0), 1725.79 (0),
  1759.8 (0), 2623.07 (0) }
[Click to access protein entry]
 Spot: 2D-001WR0 (ecoli-dige4.5-6.5)
 pI: 5.63 Mw: 32442
 %vol: 0.0587091   %od: 0.0335094
 ================
 *RSUA_ECOLI*
  accession n°: P0AA43

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DLTKPAVLEVITPTQVR(L);; $m/Z=(K)FIAQQLGVSR(A) }

  ================
 *PANC_ECOLI*
  accession n: P31663

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DFQQLALIR(K);; $m/Z=(R)NGYLTAEQR(K) }
[Click to access protein entry]
 Spot: 2D-001WN8 (ecoli-dige4.5-6.5)
 pI: 5.20 Mw: 38691
 %vol: 0.181397   %od: 0.127025
 ================
 *EFG_ECOLI*
  accession n°: P0A6M8

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)EFNVEANVGKPQVAYR(E) }

  ================
 *HEM2_ECOLI*
  accession n: P0ACB2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AGADLIFSYFALDLAEKK(I) }

  ================
 *MALE_ECOLI*
  accession n: P0AEX9

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VNYGVTVLPTFK(G);; $m/Z=(R)TAVINAASGR(Q);; $m/Z=(K)AGLTFLVDLIK(N) }
[Click to access protein entry]
 Spot: 2D-001WFQ (ecoli-dige4.5-6.5)
 pI: 5.54 Mw: 62065
 %vol: 0.127531   %od: 0.0992471
 ================
 *ILVD_ECOLI*
  accession n°: P05791

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)LVAEQIEAAGGVAK(E);; $m/Z=(K)ACALITDGR(F);; $m/Z=(K)VYESQDDAVEAILGGK(V);; $m/Z=(K)TAGVDDSILKFTGPAK(V);; $m/Z=(R)GIQLQVSDAELAARR(E);; $m/Z=(R)AGGVIGILGELDR(A);; $m/Z=(R)KVPQLCK(V);; $m/Z=(K)VSDSQSDQVER(S);; $m/Z=(K)TAGVDDSILK(F) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 858.52 (0), 976.45 (0), 985.53 (0), 1018.51 (0), 1026.58 (0),
  1046.55 (0), 1105.54 (0), 1249.54 (0), 1269.68 (0), 1355.68 (0),
  1470.77 (0), 1480.77 (0), 1484.69 (0), 1600.88 (0), 1626.88 (0),
  1640.77 (0), 1693.81 (0) }
[Click to access protein entry]
 Spot: 2D-001WDK (ecoli-dige4.5-6.5)
 pI: 5.15 Mw: 78105
 %vol: 0.0924017   %od: 0.0430938
 ================
 *PNP_ECOLI*
  accession n°: P05055

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)EGRPSEGETLIAR(L);; $m/Z=(K)AKPGQDFFPLTVNYQER(T);; $m/Z=(R)GETQALVTATLGTAR(D);; $m/Z=(R)IVDFGAFVAIGGGK(E);; $m/Z=(K)SETIATLLAEDETLDENELGEILHAIEK(N);; $m/Z=(R)YAQVDVIK(S) }
[Click to access protein entry]
 Spot: 2D-001WBM (ecoli-dige4.5-6.5)
 pI: 5.39 Mw: 94195
 %vol: 0.253359   %od: 0.138723
 ================
 *ODP1_ECOLI*
  accession n°: P0AFG8

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 921.47 (0), 964.49 (0), 1073.47 (0), 1096.59 (0), 1099.49 (0),
  1136.58 (0), 1142.69 (0), 1263.61 (0), 1288.61 (0), 1302.61 (0),
  1333.71 (0), 1503.74 (0), 1964.96 (0) }
[Click to access protein entry]
 Spot: 2D-001WGU (ecoli-dige4.5-6.5)
 pI: 5.50 Mw: 57000
 %vol: 0.270658   %od: 0.199108
 ================
 *PUR9_ECOLI*
  accession n°: P15639

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 962.56 (0), 1070.64 (0), 1142.64 (0), 1160.67 (0), 1205.66 (0),
  1237.67 (0), 1262.72 (0), 1416.8 (0), 1716.93 (0), 1831.02 (0),
  1967.91 (0) }
[Click to access protein entry]
 Spot: 2D-001WV8 (ecoli-dige4.5-6.5)
 pI: 5.00 Mw: 22748
 %vol: 0.10145   %od: 0.135088
 ================
 *IPYR_ECOLI*
  accession n°: P0A7A9

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 993.48 (0), 1021.51 (0), 1155.62 (0), 1390.75 (0), 1641.86 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WE6 (ecoli-dige4.5-6.5)
 pI: 5.06 Mw: 73587
 %vol: 0.0986292   %od: 0.0438766
 ================
 *CIRA_ECOLI*
  accession n°: P17315

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)IFEPLALTTGVR(M);; $m/Z=(R)TSDVNAAPGYQNFVGFETGANGR(R);; $m/Z=(K)VENKNPGNSSPITSESNTVDGK(Y);; $m/Z=(R)IQGVETELKIPFNDEWK(L);; $m/Z=(R)GLDSSYTLILVDGKR(V);; $m/Z=(R)RIPVFSYYNVNK(A) }
[Click to access protein entry]
 Spot: 2D-001WXJ (ecoli-dige4.5-6.5)
 pI: 5.20 Mw: 16000
 %vol: 0.168143   %od: 0.283843
 ================
 *RS6_ECOLI*
  accession n°: P02358

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)YTAAITGAEGK(I);; $m/Z=(R)QLAYPINK(L) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 931.39 (0), 946.46 (0), 1081.48 (0), 1181.55 (0), 1324.69 (0),
  1487.75 (0) }
[Click to access protein entry]
 Spot: 2D-001WDC (ecoli-dige4.5-6.5)
 pI: 5.09 Mw: 78105
 %vol: 0.171603   %od: 0.205487
 ================
 *ODP2_ECOLI*
  accession n°: P06959

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 877.47 (0), 951.48 (0), 1172.6 (0), 1239.57 (0), 1277.66 (0),
  1419.75 (0), 1519.85 (0), 1932.96 (0) }
[Click to access protein entry]
 Spot: 2D-001WN7 (ecoli-dige4.5-6.5)
 pI: 5.78 Mw: 39021
 %vol: 0.04668   %od: 0.0232603
 ================
 *YIEL_ECOLI*
  accession n°: P31471

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GIIPEDFVPQER(R) }

  ================
 *NEMA_ECOLI*
  accession n: P77258

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VGAITAANR(I);; $m/Z=(R)KAELNPQR(A);; $m/Z=(R)DWIANPDLVAR(L);; $m/Z=(K)GLIDAVAFGR(D);; $m/Z=(R)ALELEEIPGIVNDFR(Q);; $m/Z=(R)ISHASLQPGGQAPVAPSALSAGTR(T);; $m/Z=(R)ASAGLIISEATQISAQAK(G) }
[Click to access protein entry]
 Spot: 2D-001WTE (ecoli-dige4.5-6.5)
 pI: 5.17 Mw: 25686
 %vol: 0.551642   %od: 0.815525
 ================
 *FLIY_ECOLI*
  accession n°: P0AEM9

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1014.52 (0), 1061.54 (0), 1205.58 (0), 1481.73 (0), 1580.8 (0),
  1600.84 (0), 1756.92 (0), 1902.95 (0) }
[Click to access protein entry]
 Spot: 2D-001WXK (ecoli-dige4.5-6.5)
 pI: 5.15 Mw: 16000
 %vol: 0.106347   %od: 0.0956013
 ================
 *RISB_ECOLI*
  accession n°: P61714

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)IGQVKDENITVVWVPGAYELPLAAGALAK;; $m/Z=(K)TGKYDAVIALGTVIR;; $m/Z=(R)FNNFINDSLLEGAIDALKR }
[Click to access protein entry]
 Spot: 2D-001WWO (ecoli-dige4.5-6.5)
 pI: 5.53 Mw: 18722
 %vol: 0.0789353   %od: 0.0985416
 ================
 *ATPF_ECOLI*
  accession n°: P0ABA0

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)EIADGLASAER(A);; $m/Z=(R)QKEIADGLASAER(A);; $m/Z=(R)SQILDEAK(A);; $m/Z=(K)AEAQVIIEQANK(R);; $m/Z=(K)ASATDQLKK(A);; $m/Z=(R)SQILDEAKAEAEQER(T);; $m/Z=(K)IVAQAQAEIEAER(K) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 961.46 (0), 1059.56 (0), 1169.63 (0), 1297.74 (0), 1313.66 (0),
  1387.71 (0), 1427.75 (0), 1469.78 (0), 1512.82 (0), 1555.84 (0),
  1656.9 (0), 1680.89 (0), 1716.84 (0), 1887.9 (0)
  }

  ================
 *DPS_ECOLI*
  accession n: P0ABT2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)QVIQFIDLSLITK(Q);; $m/Z=(R)AVQLGGVALGTTQVINSK(T) }
[Click to access protein entry]
 Spot: 2D-001WC2 (ecoli-dige4.5-6.5)
 pI: 5.33 Mw: 88745
 %vol: 0.126839   %od: 0.0657829
 ================
 *CLPB_ECOLI*
  accession n°: P63284

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)VFVAEPSVEDTIAILR(G);; $m/Z=(R)IINGEVPEGLKGR(R) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 857.5 (0), 956.48 (0), 1010.47 (0), 1057.55 (0), 1070.57 (0),
  1085.45 (0), 1187.57 (0), 1335.65 (0), 1373.69 (0), 1381.73 (0),
  1384.71 (0), 1528.82 (0), 1560.84 (0), 1748.76 (0), 1758.93 (0),
  1774.93 (0), 1955.03 (0), 2006.04 (0), 2048.13 (0), 2124.11 (0),
  2284.25 (0), 2297.15 (0), 2453.23 (0), 2474.36 (0), 3020.55 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WJ6 (ecoli-dige4.5-6.5)
 pI: 5.16 Mw: 50036
 %vol: 0.274863   %od: 0.197789
 ================
 *TOLC_ECOLI*
  accession n°: P02930

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 913.53 (0), 1284.64 (0), 1322.75 (0), 1394.72 (0), 1615.83 (0),
  1736.89 (0), 1828.84 (0), 2033.92 (0), 2139.09 (0), 2183.1 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WW8 (ecoli-dige4.5-6.5)
 pI: 5.97 Mw: 19936
 %vol: 0.0337458   %od: 0.0438343
 ================
 *TESA_ECOLI*
  accession n°: P0ADA1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GFQPQQTEQTLR(Q);; $m/Z=(R)YNEAFSAIYPK(L);; $m/Z=(K)TSVVNASISGDTSQQGLAR(L) }
[Click to access protein entry]
 Spot: 2D-001WUK (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 23792
 %vol: 0.220252   %od: 0.337289
 ================
 *APT_ECOLI*
  accession n°: P69503

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)VLVVDDLLATGGTIEATVK(L);; $m/Z=(R)LGGEVADAAFIINLFDLGGEQR(L) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1116.45 (0), 1362.63 (0), 1502.63 (0), 1533.7 (0), 1972.94 (0),
  2304.94 (0), 2460.04 (0) }
[Click to access protein entry]
 Spot: 2D-001WO0 (ecoli-dige4.5-6.5)
 pI: 5.41 Mw: 37079
 %vol: 0.154251   %od: 0.166773
 ================
 *DEAD_ECOLI*
  accession n°: P0A9P6

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TAAFSLPLLQNLDPELKAPQILVLAPTR(E);; $m/Z=(R)ALLFVENR(E) }
[Click to access protein entry]
 Spot: 2D-001WI6 (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 52681
 %vol: 0.144777   %od: 0.102448
 ================
 *PGK_ECOLI*
  accession n°: P0A799

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)LTVLDSLSK(I);; $m/Z=(R)ASLPTIELALK(Q);; $m/Z=(K)YAALCDVFVMDAFGTAHR(A);; $m/Z=(K)VLPAVAMLEER(A);; $m/Z=(K)FADVACAGPLLAAELDALGK(A);; $m/Z=(K)IADQLIVGGGIANTFIAAQGHDVGK(S);; $m/Z=(R)LLTTCNIPVPSDVR(V);; $m/Z=(K)TILWNGPVGVFEFPNFR(K);; $m/Z=(R)AQASTHGIGK(F) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 928.45 (0), 969.37 (0), 975.43 (0), 1119.43 (0), 1155.47 (0),
  1227.5 (0), 1352.47 (0), 1411.52 (0), 1424.63 (0), 1426.6 (0),
  1464.51 (0), 1508.52 (0), 1584.58 (0), 1723.68 (0), 1874.59 (0),
  1992.65 (0), 2043.57 (0) }
[Click to access protein entry]
 Spot: 2D-001WN9 (ecoli-dige4.5-6.5)
 pI: 5.34 Mw: 38691
 %vol: 0.583206   %od: 0.619835
 ================
 *SERC_ECOLI*
  accession n°: P23721

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1002.48 (0), 1069.55 (0), 1162.61 (0), 1292.64 (0), 1322.82 (0),
  1357.66 (0), 1392.72 (0), 1408.7 (0), 1442.8 (0), 1548.78 (0),
  1564.77 (0), 1645.9 (0), 1774.86 (0), 2036.03 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WCV (ecoli-dige4.5-6.5)
 pI: 5.20 Mw: 84325
 %vol: 0.245375   %od: 0.14117
 ================
 *EFG_ECOLI*
  accession n°: P0A6M8

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1098.52 (0), 1105.49 (0), 1191.65 (0), 1254.74 (0), 1414.82 (0),
  1451.76 (0), 1531.85 (0), 1597.9 (0), 1732.92 (0), 1737.94 (0),
  1820.98 (0), 1963.07 (0), 2058.99 (0) }
[Click to access protein entry]
 Spot: 2D-001WQP (ecoli-dige4.5-6.5)
 pI: 5.36 Mw: 32716
 %vol: 0.074411   %od: 0.0713151
 ================
 *CDD_ECOLI*
  accession n°: P0ABF6

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TPLSNFNVGAIAR(G);; $m/Z=(K)GYDYPDIQR(A);; $m/Z=(K)SPSGVALECK(D);; $m/Z=(K)SATGLDEDALAFALLPLAAACAR(T) }
[Click to access protein entry]
 Spot: 2D-001WQS (ecoli-dige4.5-6.5)
 pI: 5.60 Mw: 32613
 %vol: 0.172774   %od: 0.196519
 ================
 *FABI_ECOLI*
  accession n°: P0AEK4

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)VNAISAGPIR(T);; $m/Z=(K)FDGFVHSIGFAPGDQLDGDYVNAVTR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 859.43 (0), 887.48 (0), 997.53 (0), 1043.6 (0), 1430.75 (0),
  1485.67 (0), 1553.8 (0), 1639.8 (0), 1726.87 (0), 1993.1 (0),
  2797.44 (0) }
[Click to access protein entry]
 Spot: 2D-001WE0 (ecoli-dige4.5-6.5)
 pI: 5.91 Mw: 74850
 %vol: 0.0277311   %od: 0.00870878
 ================
 *SYQ_ECOLI*
  accession n°: P00962

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(-)SEAEARPTNFIR(Q) }
[Click to access protein entry]
 Spot: 2D-001WQY (ecoli-dige4.5-6.5)
 pI: 5.07 Mw: 32442
 %vol: 0.0548236   %od: 0.042115
 ================
 *EFTU2_ECOLI*
  accession n°: P0CE48

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AIDKPFLLPIEDVFSISGR(G) }
[Click to access protein entry]
 Spot: 2D-001WUJ (ecoli-dige4.5-6.5)
 pI: 5.48 Mw: 24005
 %vol: 0.123912   %od: 0.1292
 ================
 *WRBA_ECOLI*
  accession n°: P0A8G6

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1059.43 (0), 1257.69 (0), 1297.65 (0), 1431.77 (0), 1537.77 (0),
  1587.88 (0) }
[Click to access protein entry]
 Spot: 2D-001WKH (ecoli-dige4.5-6.5)
 pI: 6.02 Mw: 45274
 %vol: 0.065256   %od: 0.0422628
 ================
 *GLYA_ECOLI*
  accession n°: P0A825

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)TYQQQVAK(N);; $m/Z=(K)NSVPNDPKSPFVTSGIR(V);; $m/Z=(K)GGSEELYK(K) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 846.45 (0), 963.47 (0), 1040.44 (0), 1109.49 (0), 1320.58 (0),
  1478.7 (0), 1814.91 (0), 2065.94 (0), 2163.01 (0), 2480.19 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WO6 (ecoli-dige4.5-6.5)
 pI: 4.71 Mw: 37000
 %vol: 0.0303925   %od: 0.0109057
 ================
 *OMPF_ECOLI*
  accession n°: P02931

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)YADVGSFDYGR(N);; $m/Z=(R)NSNFFGLVDGLNFAVQYLGK(N) }
[Click to access protein entry]
 Spot: 2D-001WQA (ecoli-dige4.5-6.5)
 pI: 5.44 Mw: 33098
 %vol: 0.0631269   %od: 0.0316141
 ================
 *PROX_ECOLI*
  accession n°: P0AFM2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AHQQQFDGWVNEALAAQK;; $m/Z=(R)EGVFVNGAAQGYLIDKK(T);; $m/Z=(K)GITVNPVQSTITEETFQTLLVSR(A) }

  ================
 *HCHA_ECOLI*
  accession n: P31658

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)YLPTDNGK(L);; $m/Z=(K)ILVIAADER(Y) }
[Click to access protein entry]
 Spot: 2D-001WFZ (ecoli-dige4.5-6.5)
 pI: 5.22 Mw: 61539
 %vol: 0.049075   %od: 0.0161223
 ================
 *ADEC_ECOLI*
  accession n°: P31441

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VASWSTAR(H);; $m/Z=(R)QPVSASDFALQFTPGKR(Y) }
[Click to access protein entry]
 Spot: 2D-001WXA (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 16076
 %vol: 0.453653   %od: 0.937742
 ================
 *RS6_ECOLI*
  accession n°: P02358

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)RQLAYPINK(L);; $m/Z=(R)QLAYPINK(L);; $m/Z=(R)YTAAITGAEGK(I) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 931.43 (0), 946.46 (0), 1081.47 (0), 1102.6 (0), 1181.56 (0),
  1398.68 (0), 1487.78 (0), 2056.81 (0), 2704.4 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WIH (ecoli-dige4.5-6.5)
 pI: 5.22 Mw: 52046
 %vol: 0.146746   %od: 0.10724
 ================
 *ILVC_ECOLI*
  accession n°: P05793

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LIQFGWETITEALK(Q);; $m/Z=(K)AIPEGAVDNGQLRDVNEAIR(S);; $m/Z=(R)DSGLDISYALRK(E);; $m/Z=(R)AGVLESSFVAEVK(S) }

  ================
 *PEPD_ECOLI*
  accession n: P15288

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LIDFNGGTLR(N) }
[Click to access protein entry]
 Spot: 2D-001WCU (ecoli-dige4.5-6.5)
 pI: 5.29 Mw: 85046
 %vol: 0.198589   %od: 0.123611
 ================
 *EFG_ECOLI*
  accession n°: P0A6M8

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1191.57 (0), 1414.72 (0), 1701.8 (0), 1732.78 (0), 1820.89 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WKD (ecoli-dige4.5-6.5)
 pI: 5.83 Mw: 45411
 %vol: 0.0390684   %od: 0.0175817
 ================
 *SURA_ECOLI*
  accession n°: P0ABZ6

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 954.58 (0), 992.47 (0), 1120.6 (0), 1156.6 (0), 1227.78 (0),
  1282.6 (0), 1562.9 (0), 1742.79 (0) }
[Click to access protein entry]
 Spot: 2D-001WLA (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 43494
 %vol: 0.228343   %od: 0.115482
 ================
 *PURA_ECOLI*
  accession n°: P0A7D4

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VGDLFDKETFAEK(L);; $m/Z=(K)RIEELTGVPIDIISTGPDR(T);; $m/Z=(K)LDVLDGLKEVK(L);; $m/Z=(K)IVDLLTER(A);; $m/Z=(R)YQGGHNAGHTLVINGEK(T);; $m/Z=(K)TVLHLIPSGILR(E);; $m/Z=(R)LLLSEACPLILDYHVALDNAR(E);; $m/Z=(R)GIGPAYEDK(V);; $m/Z=(K)AEAVDYQK(V);; $m/Z=(R)YVDYVLGILK(A);; $m/Z=(R)SGLPQAALNYIK(R);; $m/Z=(R)TGWLDTVAVR(R);; $m/Z=(R)AVQLNSLSGFCLTK(L) }
[Click to access protein entry]
 Spot: 2D-001WHP (ecoli-dige4.5-6.5)
 pI: 5.44 Mw: 53485
 %vol: 0.220093   %od: 0.148199
 ================
 *AHPF_ECOLI*
  accession n°: P35340

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)EDNSLPVR(K);; $m/Z=(K)LTKPVELIATLDDSAK(S);; $m/Z=(K)ADQVLQDK(L);; $m/Z=(R)FGGQILDTVDIENYISVPK(T);; $m/Z=(K)EAQSLLEQIR(H);; $m/Z=(K)ELLAEIAELSDK(V);; $m/Z=(K)QIIIATGEGAK(A);; $m/Z=(K)ASLSAFDYLIR(T);; $m/Z=(R)SIIVATGAK(W) }
[Click to access protein entry]
 Spot: 2D-001WMM (ecoli-dige4.5-6.5)
 pI: 5.15 Mw: 39861
 %vol: 0.929393   %od: 1.11193
 ================
 *ATPA_ECOLI*
  accession n°: P0ABB0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)CIYVAIGQK(A);; $m/Z=(R)DRGEDALIIYDDLSK(Q);; $m/Z=(R)EAFPGDVFYLHSR(L);; $m/Z=(R)VNAEYVEAFTK(G);; $m/Z=(-)MQLNSTEISELIK(Q);; $m/Z=(R)ELAAFSQFASDLDDATR(K);; $m/Z=(R)ELAAFSQFASDLDDATRK(Q);; $m/Z=(K)QYAPMSVAQQSLVLFAAER(G);; $m/Z=(R)IAQFNVVSEAHNEGTIVSVSDGVIR(I);; $m/Z=(R)YAIALNLER(D);; $m/Z=(R)VVNTLGAPIDGK(G);; $m/Z=(K)TALAIDAIINQR(D);; $m/Z=(K)GPLDHDGFSAVEAIAPGVIER(Q) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 882.42 (0), 946.4 (0), 953.33 (0), 1051.36 (0), 1058.37 (0),
  1062.44 (0), 1094.36 (0), 1270.4 (0), 1298.53 (0), 1349.4 (0),
  1505.49 (0), 1524.54 (0), 1537.46 (0), 1722.52 (0), 1856.51 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WMU (ecoli-dige4.5-6.5)
 pI: 5.07 Mw: 39523
 %vol: 0.452373   %od: 0.497243
 ================
 *RPOA_ECOLI*
  accession n°: P0A7Z4

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)LLVDACYSPVER(I);; $m/Z=(K)SLTEIKDVLASR(G);; $m/Z=(K)EGVQEDILEILLNLK(G);; $m/Z=(R)IHSEEDERPIGR(L) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 850.43 (0), 956.48 (0), 970.46 (0), 1006.46 (0), 1063.46 (0),
  1142.51 (0), 1298.57 (0), 1331.63 (0), 1392.59 (0), 1421.6 (0),
  1437.57 (0), 1456.7 (0), 1484.66 (0), 1725.76 (0), 1759.8 (0),
  1915.84 (0), 2157.87 (0), 2222.02 (0), 2623.09 (0), 2800.06 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WU3 (ecoli-dige4.5-6.5)
 pI: 5.83 Mw: 24964
 %vol: 0.106879   %od: 0.117964
 ================
 *PYRF_ECOLI*
  accession n°: P08244

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AINASLQR(S);; $m/Z=(K)LVTPGIRPQGSEAGDQR(R) }

  ================
 *NFNB_ECOLI*
  accession n: P38489

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)TLLQYSPSSTNSQPWHFIVASTEEGK(A);; $m/Z=(K)SAAGNYVFNERK(M);; $m/Z=(K)LVVDQEDADGR(F);; $m/Z=(K)LVVDQEDADGRFATPEAK(A) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1156.52 (0), 1216.5 (0), 1227.5 (0), 1284.62 (0), 1355.61 (0),
  1370.72 (0), 1960.96 (0), 2566.28 (0), 2823.41 (0), 2907.38 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WT8 (ecoli-dige4.5-6.5)
 pI: 5.15 Mw: 26055
 %vol: 0.260332   %od: 0.256241
 ================
 *ARGT_ECOLI*
  accession n°: P09551

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)IDAIISSLSITDK(R);; $m/Z=(R)KDDAELTAAFNK(A);; $m/Z=(R)LDAALQDEVAASEGFLK(Q);; $m/Z=(K)YFGDGTGVGLR(K);; $m/Z=(K)GVDVVAYANQDLVYSDLAAGR(L);; $m/Z=(K)GSPIQPTLDSLK(G);; $m/Z=(R)QQEIAFSDK(L);; $m/Z=(K)IDAIISSLSITDKR(Q) }
[Click to access protein entry]
 Spot: 2D-001WUQ (ecoli-dige4.5-6.5)
 pI: 5.46 Mw: 23581
 %vol: 0.177564   %od: 0.268596
 ================
 *HIS4_ECOLI*
  accession n°: P10371

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1359.78 (0), 1529.84 (0), 1622 (0), 1641.94 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WS6 (ecoli-dige4.5-6.5)
 pI: 5.90 Mw: 28059
 %vol: 0.0654689   %od: 0.0651667
 ================
 *DLDH_ECOLI*
  accession n°: P0A9P0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)AGVEVDDRGFIR(V);; $m/Z=(K)APAEPQRYDAVLVAIGR(V);; $m/Z=(R)YDAVLVAIGR(V);; $m/Z=(K)VIPSIAYTEPEVAWVGLTEK(E) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 860.4 (0), 896.44 (0), 934.42 (0), 1076.56 (0), 1144.56 (0),
  1333.65 (0), 1473.76 (0), 1571.82 (0), 1601.86 (0), 1713.83 (0),
  1825.98 (0), 1971.01 (0), 2202.14 (0) }
[Click to access protein entry]
 Spot: 2D-001WLP (ecoli-dige4.5-6.5)
 pI: 5.38 Mw: 41860
 %vol: 2.69647   %od: 6.32573
 ================
 *EFTU2_ECOLI*
  accession n°: P0CE48

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1171.69 (0), 1187.58 (0), 1214.69 (0), 1233.6 (0), 1376.67 (0),
  1797.02 (0), 2117.36 (0) }
[Click to access protein entry]
 Spot: 2D-001WPF (ecoli-dige4.5-6.5)
 pI: 5.08 Mw: 34633
 %vol: 0.0571123   %od: 0.0228503
 ================
 *EFTS_ECOLI*
  accession n°: P0A6P1

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DAGFQAFADKVLDAAVAGK(I) }

  ================
 *ENTB_ECOLI*
  accession n: P0ADI4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LTPDADDTVLVK(W) }
[Click to access protein entry]
 Spot: 2D-001WVR (ecoli-dige4.5-6.5)
 pI: 5.02 Mw: 21096
 %vol: 0.0411442   %od: 0.0945682
 ================
 *DYR_ECOLI*
  accession n°: P0ABQ4

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)NIILSSQPGTDDR(V) }
[Click to access protein entry]
 Spot: 2D-001WLG (ecoli-dige4.5-6.5)
 pI: 6.00 Mw: 43217
 %vol: 0.0746772   %od: 0.0544012
 ================
 *GLYA_ECOLI*
  accession n°: P0A825

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TYQQQVAK(N);; $m/Z=(K)NSVPNDPKSPFVTSGIR(V) }
[Click to access protein entry]
 Spot: 2D-001WU5 (ecoli-dige4.5-6.5)
 pI: 5.59 Mw: 24831
 %vol: 0.0855354   %od: 0.103001
 ================
 *ARTJ_ECOLI*
  accession n°: P30860

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VTDPQYFGTGLGIAVRPDNK(A);; $m/Z=(R)SKQVSFTTPYYENSAVVIAK(K);; $m/Z=(K)LNNALAAIK(A) }
[Click to access protein entry]
 Spot: 2D-001WKM (ecoli-dige4.5-6.5)
 pI: 5.94 Mw: 44524
 %vol: 0.0841515   %od: 0.0429111
 ================
 *DHE4_ECOLI*
  accession n°: P00370

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)LSNNTACVFTGK(G);; $m/Z=(R)NQIQVNR(A);; $m/Z=(R)VQFSSAIGPYK(G);; $m/Z=(K)FLGFEQTFK(N) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 888.41 (0), 1116.49 (0), 1196.53 (0), 1254.62 (0), 1375.58 (0),
  1531.67 (0), 1608.71 (0), 1706.75 (0), 1740.8 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WBD (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 95000
 %vol: 0.306799   %od: 0.24793
 ================
 *ACON2_ECOLI*
  accession n°: P36683

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 931.53 (0), 1244.6 (0), 1247.62 (0), 1534.78 (0), 1565.74 (0),
  1600.65 (0), 1681.81 (0), 1880.92 (0) }
[Click to access protein entry]
 Spot: 2D-001WWI (ecoli-dige4.5-6.5)
 pI: 5.30 Mw: 19078
 %vol: 0.0674383   %od: 0.087191
 ================
 *AROK_ECOLI*
  accession n°: P0A6D7

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1143.62 (0), 1186.69 (0), 1203.67 (0), 1219.66 (0), 1314.8 (0),
  1350.77 (0), 1442.91 (0), 1483.73 (0), 1532.82 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WTW (ecoli-dige4.5-6.5)
 pI: 5.94 Mw: 25009
 %vol: 0.237125   %od: 0.377084
 ================
 *ARTJ_ECOLI*
  accession n°: P30860

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1157.62 (0), 1256.66 (0), 1566.75 (0), 1582.79 (0), 1694.89 (0),
  1710.86 (0), 1763.8 (0), 2016.98 (0), 2148.1 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WIU (ecoli-dige4.5-6.5)
 pI: 5.82 Mw: 50800
 %vol: 0.468237   %od: 0.285198
 ================
 *DLDH_ECOLI*
  accession n°: P0A9P0

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1011.49 (0), 1076.62 (0), 1139.62 (0), 1144.64 (0), 1257.61 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WV1 (ecoli-dige4.5-6.5)
 pI: 5.20 Mw: 23000
 %vol: 0.204231   %od: 0.374595
 ================
 *LEUD_ECOLI*
  accession n°: P30126

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)LSDAEVDELFALVK(A);; $m/Z=(K)VVIAPSFADIFYGNSFNNQLLPVK(L);; $m/Z=(K)GQQPNPDFVLNFPQYQGASILLAR(E) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 869.41 (0), 1025.44 (0), 1420.49 (0), 1543.49 (0), 1548.56 (0),
  1881.63 (0), 2158.79 (0), 2672.86 (0) }
[Click to access protein entry]
 Spot: 2D-001WC1 (ecoli-dige4.5-6.5)
 pI: 4.91 Mw: 88368
 %vol: 0.0962872   %od: 0.0518882
 ================
 *LPTD_ECOLI*
  accession n°: P31554

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 904.51 (0), 945.49 (0), 1078.55 (0), 1171.59 (0), 1307.63 (0),
  1403.75 (0), 1479.76 (0), 1546.66 (0), 1567.75 (0), 1640.78 (0),
  1822.89 (0), 1831.89 (0), 1858.93 (0), 1882.85 (0), 2013 (0),
  2085.98 (0) }
[Click to access protein entry]
 Spot: 2D-001WQW (ecoli-dige4.5-6.5)
 pI: 5.49 Mw: 32476
 %vol: 0.206733   %od: 0.152505
 ================
 *DAPD_ECOLI*
  accession n°: P0A9D8

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)EAVNQVIALLDSGALR(V);; $m/Z=(K)VGINELLR(T);; $m/Z=(K)YSLYCAVIVK(K);; $m/Z=(R)VPAGSVVVSGNLPSKDGK(Y);; $m/Z=(R)VPAGSVVVSGNLPSK(D);; $m/Z=(R)ETGEIHYGR(V);; $m/Z=(R)SEVVEGVIVEEGSVISMGVYIGQSTR;; $m/Z=(K)FADYDEAR(F);; $m/Z=(R)INDNQVIEGAESR(Y) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 913.52 (0), 986.41 (0), 1668.89 (0), 1736.87 (0)
  }

  ================
 *ZNUA_ECOLI*
  accession n: P39172

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ATCVFAEPQFRPAVVESVAR(G) }
[Click to access protein entry]
 Spot: 2D-001WP0 (ecoli-dige4.5-6.5)
 pI: 4.88 Mw: 35000
 %vol: 0.385574   %od: 0.455038
 ================
 *NLPB_ECOLI*
  accession n°: P0A903

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ALDIRPPAQPLALVSGAR(T) }

  ================
 *POTD_ECOLI*
  accession n: P0AFK9

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GSLLLTDDAR(E);; $m/Z=(K)LINFLLRPDVAK(Q);; $m/Z=(R)QAGTPIDVVWPK(E) }
[Click to access protein entry]
 Spot: 2D-001WTU (ecoli-dige4.5-6.5)
 pI: 5.69 Mw: 25098
 %vol: 0.0811708   %od: 0.129669
 ================
 *EFTU2_ECOLI*
  accession n°: P0CE48

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VGEEVEIVGIKETQK(S);; $m/Z=(R)AIDKPFLLPIEDVFSISGR(G);; $m/Z=(K)LLDEGRAGENVGVLLR(G);; $m/Z=(R)AGENVGVLLR(G);; $m/Z=(R)GTVVTGRVER(G) }
[Click to access protein entry]
 Spot: 2D-001WPY (ecoli-dige4.5-6.5)
 pI: 5.58 Mw: 33803
 %vol: 0.0632866   %od: 0.0272151
 ================
 *YHDH_ECOLI*
  accession n°: P26646

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1148.66 (0), 1319.73 (0), 1389.77 (0), 1444.76 (0), 1652.91 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WWT (ecoli-dige4.5-6.5)
 pI: 5.15 Mw: 17637
 %vol: 0.0484363   %od: 0.0968906
 ================
 *NLPA_ECOLI*
  accession n°: P04846

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)EGATVAIPNDPTNLGR(A);; $m/Z=(K)EFLQSYQSPEVAK(A);; $m/Z=(K)NSPYVNILVAR(E);; $m/Z=(K)GLLPTALDITDNPR(H) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1160.44 (0), 1245.58 (0), 1495.69 (0), 1525.64 (0), 1624.68 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WIC (ecoli-dige4.5-6.5)
 pI: 5.11 Mw: 52363
 %vol: 0.119547   %od: 0.0810386
 ================
 *ALDA_ECOLI*
  accession n°: P25553

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GYYYPPTLLLDVR(Q);; $m/Z=(R)GETVGQELAGNPK(V);; $m/Z=(R)GVFNLVLGR(G);; $m/Z=(R)RYEGEIIQSDRPGENILLFK(R);; $m/Z=(R)ASEISALIVEEGGK(I);; $m/Z=(R)AQPEWEALPAIER(A);; $m/Z=(K)FGETYINR(E);; $m/Z=(K)GIYDQFVNR(L) }

  ================
 *GPMI_ECOLI*
  accession n: P37689

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AFFANPVLTGAVDK(A);; $m/Z=(R)EEQQDNAIFSAK(T);; $m/Z=(R)AFVNADFDGFAR(K);; $m/Z=(K)AYDLLTLAQGEFQADTAVAGLQAAYAR }
[Click to access protein entry]
 Spot: 2D-001WFL (ecoli-dige4.5-6.5)
 pI: 4.91 Mw: 63671
 %vol: 0.297751   %od: 0.257644
 ================
 *PT1_ECOLI*
  accession n°: P08839

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)ASAQLETIK(T);; $m/Z=(K)VLGFITDAGGR(T) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 938.41 (0), 960.51 (0), 967.42 (0), 1035.55 (0), 1074.53 (0),
  1088.58 (0), 1388.73 (0), 1430.81 (0), 1477.88 (0), 1766.07 (0),
  1987.94 (0) }
[Click to access protein entry]
 Spot: 2D-001WU0 (ecoli-dige4.5-6.5)
 pI: 5.51 Mw: 24964
 %vol: 0.345708   %od: 0.510959
 ================
 *THIE_ECOLI*
  accession n°: P30137

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LFINDYWR(L);; $m/Z=(R)LADYPTVAIGGISLAR(A);; $m/Z=(K)HQAYGVHLGQEDLQATDLNAIR(A);; $m/Z=(R)LAIKHQAYGVHLGQEDLQATDLNAIR;; $m/Z=(R)SGLYPVVDSVQWIER(L) }

  ================
 *ZINT_ECOLI*
  accession n: P76344

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AANGVFDDANVQNR;; $m/Z=(K)YIQFSDHIIAPR;; $m/Z=(R)TLSDWDGVWQSVYPLLQSGKLDPVFQK }
[Click to access protein entry]
 Spot: 2D-001WN5 (ecoli-dige4.5-6.5)
 pI: 4.85 Mw: 38938
 %vol: 0.0548768   %od: 0.0444299
 ================
 *PTFAH_ECOLI*
  accession n°: P69811

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LKEAGAVDATFVTK(A);; $m/Z=(R)LADLLLDNKADR(A);; $m/Z=(K)SATTAEELR(A) }
[Click to access protein entry]
 Spot: 2D-001WM0 (ecoli-dige4.5-6.5)
 pI: 5.88 Mw: 42128
 %vol: 0.133919   %od: 0.105318
 ================
 *CARA_ECOLI*
  accession n°: P0A6F1

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)FLETDIPVFGICLGHQLLALASGAK(T);; $m/Z=(K)KEDELPFHVVAYDFGAK(R);; $m/Z=(K)SALLVLEDGTQFHGR(A);; $m/Z=(K)EVTTAEAYSWTQGSWTLTGGLPEAK(K);; $m/Z=(R)NTEDLSSYLK(R);; $m/Z=(K)SLFDGTLQGIHR(T);; $m/Z=(R)LTIVPAQTSAEDVLK(M) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1145.51 (0), 1186.47 (0), 1325.55 (0), 1337.59 (0), 1343.59 (0),
  1493.66 (0), 1642.72 (0), 1657.65 (0), 1964.75 (0), 4064.65 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WNX (ecoli-dige4.5-6.5)
 pI: 4.64 Mw: 37000
 %vol: 0.201144   %od: 0.202388
 ================
 *OMPF_ECOLI*
  accession n°: P02931

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)YADVGSFDYGR(N);; $m/Z=(K)NMSTYVDYIINQIDSDNK(L);; $m/Z=(K)FTNTSGFANK(T);; $m/Z=(K)YDANNIYLAANYGETR(N);; $m/Z=(R)TNLQEAQPLGNGK(K);; $m/Z=(R)RSNGDGVGGSISYEYEGFGIVGAYGAADR(T);; $m/Z=(R)NSNFFGLVDGLNFAVQYLGK(N) }
[Click to access protein entry]
 Spot: 2D-001WNR (ecoli-dige4.5-6.5)
 pI: 5.38 Mw: 37715
 %vol: 0.0747304   %od: 0.0191866
 ================
 *AROF_ECOLI*
  accession n°: P00888

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AAFPLSLQQEAQIADSRK(S) }

  ================
 *ASNA_ECOLI*
  accession n: P00963

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DLGAVFLVGIGGK(L);; $m/Z=(K)STVEAIWAGIK(A);; $m/Z=(R)LGLIEVQAPILSR(V) }
[Click to access protein entry]
 Spot: 2D-001WH2 (ecoli-dige4.5-6.5)
 pI: 5.65 Mw: 56143
 %vol: 0.0855354   %od: 0.0593819
 ================
 *KPYK1_ECOLI*
  accession n°: P0AD61

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1031.54 (0), 1149.6 (0), 1172.6 (0), 1185.54 (0), 1216.59 (0),
  1246.58 (0), 1381.85 (0), 1649.02 (0), 1825.02 (0)
  }
[Click to access protein entry]
 Spot: 2D-001WTV (ecoli-dige4.5-6.5)
 pI: 5.27 Mw: 24964
 %vol: 0.314943   %od: 0.447197
 ================
 *ARTI_ECOLI*
  accession n°: P30859

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)YTSVDQLK(G);; $m/Z=(R)QGNTELQQKLNTALEK(V);; $m/Z=(K)QVLFTTPYYDNSALFVGQQGK(Y);; $m/Z=(K)VTDKDYFGTGLGIAVR(Q) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 953.43 (0), 1138.56 (0), 1168.58 (0), 1711.93 (0), 1792.85 (0),
  1814.93 (0), 2376.2 (0), 2633.3 (0) }
[Click to access protein entry]
 Spot: 2D-001WWV (ecoli-dige4.5-6.5)
 pI: 5.10 Mw: 17526
 %vol: 0.0928275   %od: 0.0837643
 ================
 *DUT_ECOLI*
  accession n°: P06968

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VGKEFPLPTYATSGSAGLDLR(A);; $m/Z=(R)GQDSFTIQPGER(I) }

  ================
 *BCP_ECOLI*
  accession n: P0AE52

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AGVDVLGISTDKPEK(L);; $m/Z=(R)VLVYFYPK(A) }
[Click to access protein entry]
 Spot: 2D-001WD2 (ecoli-dige4.5-6.5)
 pI: 5.16 Mw: 80468
 %vol: 0.168835   %od: 0.0949707
 ================
 *PNP_ECOLI*
  accession n°: P05055

   Identification Methods:
  * EXPRESSION, MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 935.5 (0), 991.45 (0), 1116.64 (0), 1206.65 (0), 1260.69 (0),
  1309.72 (0), 1622.84 (0), 1971.03 (0), 2010.06 (0), 2022.02 (0),
  2081.99 (0) }
[Click to access protein entry]
 Spot: 2D-001WI2 (ecoli-dige4.5-6.5)
 pI: 5.15 Mw: 52681
 %vol: 0.187731   %od: 0.161483
 ================
 *GPMI_ECOLI*
  accession n°: P37689

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)AFVNADFDGFAR(K);; $m/Z=(K)YAHVTFFFNGGVEESFKGEDR(I);; $m/Z=(R)AFFANPVLTGAVDK(A);; $m/Z=(K)AYDLLTLAQGEFQADTAVAGLQAAYAR;; $m/Z=(R)DENDEFVK(A) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 861.35 (0), 874.42 (0), 987.46 (0), 995.32 (0), 1007.46 (0),
  1204.51 (0), 1329.47 (0), 1449.56 (0), 1569.57 (0), 1625.63 (0),
  1770.7 (0), 1978.64 (0), 2435.82 (0), 2514.98 (0), 2827.06 (0),
  2984.07 (0), 3026.98 (0), 3043.99 (0) }
[Click to access protein entry]
 Spot: 2D-001WR2 (ecoli-dige4.5-6.5)
 pI: 5.14 Mw: 32339
 %vol: 0.056793   %od: 0.0535378
 ================
 *SPEB_ECOLI*
  accession n°: P60651

   Identification Methods:
  * EXPRESSION, MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)EGLIDPNHSVQIGIR(T) }
[Click to access protein entry]
 Spot: 2D-001WK7 (ecoli-dige4.5-6.5)
 pI: 5.81 Mw: 46385
 %vol: 0.0317232   %od: 0.0329019
 ================
 *DHE4_ECOLI*
  accession n°: P00370

   Identification Methods:
  * MAPPING: {PMF}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1116.58 (0), 1148.46 (0), 1175.64 (0), 1196.66 (0), 1375.71 (0),
  1531.8 (0), 1899.97 (0) }
SWISS-2DPAGE image

 SWISS-2DPAGE Viewer
 ECOLI-DIGE4.5-6.5 { Escherichia coli DIGE (4.5-6.5) } (All identified proteins)

             Back to the
SWISS-2DPAGE imagesearch engine

Switch to Gel: 


Re-scale Gel from 100% to:  View: 


      Display:   Identified spots    Identification details:  show hide
details:  PMF  Tandem MS  AA Composition  Micro-Sequencing / Tagging  Gel Matching  Comigration  Immunobloting
 

  -Get more information by dragging your mouse pointer over any highlighted spot  -Click on a highlighted spot to access all its associated protein entries
/swiss-2dpage/data/gifs/swiss_2dpage/ECOLI-DIGE4.5-6.5.gif
Back to the
SWISS-2DPAGE imagesearch engine