World-2DPAGE Home
Home  |  Contact
[Click to access protein entry]
 Spot: 783 (ob21dsub)
 pI: 6.78 Mw: 54000
 %vol: 0.0758277   %od: 0.0968295
 ================
 *SYN2_RAT*
  accession n°: Q63537

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=RPPPAQAPAPQPAPQPAPTPSVGSSFFSSLSQAVK;; $m/Z=QTAASAGLVDAPAPSAASR;; $m/Z=VLLVVDEPHTDWAK;; $m/Z=SFRPDFVLIR;; $m/Z=QHAFGMAENEDFR;; $m/Z=FPLIEQTYYPNHR;; $m/Z=TSISGNWK;; $m/Z=TNTGSAMoxLEQIAMoxSDR;; $m/Z=TPALSPQRPLTTQQPQSGTLK;; $m/Z=TPALSPQRPLTTQQPQSGTLKEPDSSK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 892.4933 (0), 1249.7178 (0), 1551.7418 (0),
  1621.8398 (0), 1677.8512 (0), 1740.8789 (0), 1756.8267 (0),
  2249.2139 (0), 2892.458 (0), 3497.7776 (0)
  }
World-2DPAGE Repository image

 World-2DPAGE Repository Viewer (0004)
 OB21DSUB { 2-DE gel for Olfactory bulb proteome } (AC: Q63537)

Home page of the World-2DPAGE Repository
             Back to the
World-2DPAGE Repository imagesearch engine

Switch to Gel: 

Database: 

Re-scale Gel from 100% to:  View: 


      Display:   Identified spots    Identification details:  show hide
details:  PMF  Tandem MS  AA Composition  Micro-Sequencing / Tagging  Gel Matching  Comigration  Immunobloting
 

  -Get more information by dragging your mouse pointer over any highlighted spot  -Click on a highlighted spot to access all its associated protein entries
/repository/data/gifs/submission_0004/OB21DSUB.jpg
Back to the
World-2DPAGE Repository imagesearch engine