Attention: World-2DPAGE is no longer maintained.
World-2DPAGE Repository no longer accepts submissions.
[Click to access protein entry]
Spot: 783 (ob21dsub)
pI: 6.78 Mw: 54000
%vol: 0.0758277 %od: 0.0968295
================
*SYN2_RAT*
accession n°: Q63537
Identification Methods:
* MAPPING: {MS/MS} {PMF}
peptide sequences: {
$m/Z=RPPPAQAPAPQPAPQPAPTPSVGSSFFSSLSQAVK;; $m/Z=QTAASAGLVDAPAPSAASR;; $m/Z=VLLVVDEPHTDWAK;; $m/Z=SFRPDFVLIR;; $m/Z=QHAFGMAENEDFR;; $m/Z=FPLIEQTYYPNHR;; $m/Z=TSISGNWK;; $m/Z=TNTGSAMoxLEQIAMoxSDR;; $m/Z=TPALSPQRPLTTQQPQSGTLK;; $m/Z=TPALSPQRPLTTQQPQSGTLKEPDSSK }
peptide masses: { (TRYPSIN)
$m/Z= 892.4933 (0), 1249.7178 (0), 1551.7418 (0),
1621.8398 (0), 1677.8512 (0), 1740.8789 (0), 1756.8267 (0),
2249.2139 (0), 2892.458 (0), 3497.7776 (0)
}
Spot: 783 (ob21dsub)
pI: 6.78 Mw: 54000
%vol: 0.0758277 %od: 0.0968295
================
*SYN2_RAT*
accession n°: Q63537
Identification Methods:
* MAPPING: {MS/MS} {PMF}
peptide sequences: {
$m/Z=RPPPAQAPAPQPAPQPAPTPSVGSSFFSSLSQAVK;; $m/Z=QTAASAGLVDAPAPSAASR;; $m/Z=VLLVVDEPHTDWAK;; $m/Z=SFRPDFVLIR;; $m/Z=QHAFGMAENEDFR;; $m/Z=FPLIEQTYYPNHR;; $m/Z=TSISGNWK;; $m/Z=TNTGSAMoxLEQIAMoxSDR;; $m/Z=TPALSPQRPLTTQQPQSGTLK;; $m/Z=TPALSPQRPLTTQQPQSGTLKEPDSSK }
peptide masses: { (TRYPSIN)
$m/Z= 892.4933 (0), 1249.7178 (0), 1551.7418 (0),
1621.8398 (0), 1677.8512 (0), 1740.8789 (0), 1756.8267 (0),
2249.2139 (0), 2892.458 (0), 3497.7776 (0)
}
 |
World-2DPAGE Repository Viewer (0004)
Home page of the World-2DPAGE Repository
|
Back to the search engine |
-Get more information by dragging your mouse pointer over any highlighted spot -Click on a highlighted spot to access all its associated protein entries
Back to the
search engine