World-2DPAGE Home
Home  |  Contact
[Click to access protein entry]
 Spot: 690 (ob21dsub)
 pI: 6.61 Mw: 21000
 %vol: 0.134386   %od: 0.0915208
 ================
 *TAGL3_RAT*
  accession n°: P37805

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TTDIFQTVDLWEGK;; $m/Z=LINSLYPPGQEPIPK;; $m/Z=MAFKQMEQISQFLK;; $m/Z=GEPSWFHR;; $m/Z=GFSEEQLR;; $m/Z=GPSYGLSR;; $m/Z=TTDIFQTVDLWEGKDMoxAAVQR;; $m/Z=QMoxEQISQFLK;; $m/Z=RGFSEEQLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 836.4 (0), 965.4453 (0), 1015.4471 (0), 1121.5472 (0),
  1267.6007 (0), 1652.7791 (0), 1665.8856 (0), 1728.8456 (0),
  2440.1748 (0) }
[Click to access protein entry]
 Spot: 639 (ob21dsub)
 pI: 7.09 Mw: 26000
 %vol: 0.305024   %od: 0.208989
 ================
 *RAN_RAT*
  accession n°: P62828

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NVPNWHR;; $m/Z=SNYNFEKPFLWLAR;; $m/Z=YVATLGVEVHPLVFHTNR;; $m/Z=KYVATLGVEVHPLVFHTNR;; $m/Z=DGYYIQAQCcamAIIMFDVTSR;; $m/Z=DGYYIQAQCcamAIIMoxFDVTSR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 922.4205 (0), 1784.8473 (0), 2052.0266 (0),
  2180.1218 (0), 2250.9673 (0), 2266.9631 (0)
  }
[Click to access protein entry]
 Spot: 424 (ob21dsub)
 pI: 5.82 Mw: 46000
 %vol: 0.125265   %od: 0.157248
 ================
 *ACTB_RAT*
  accession n°: P60711

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AGFAGDDAPR;; $m/Z=AVFPSIVGRPR;; $m/Z=AVFPSIVGRPRHQGVMoxVGMGQK;; $m/Z=IWHHTFYNELR;; $m/Z=VAPEEHPVLLTEAPLNPK;; $m/Z=GYSFTTTAER;; $m/Z=EKLCYVALDFEQEMATAASSSSLEK;; $m/Z=SYELPDGQVITIGNER;; $m/Z=DLYANTVLSGGTTMoxYPGIADR;; $m/Z=MoxQKEITALAPSTMK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 976.4968 (0), 1132.5814 (0), 1198.754 (0),
  1515.8094 (0), 1564.8065 (0), 1790.954 (0), 1954.126 (0),
  2231.1641 (0), 2367.3318 (0), 2807.3865 (0)
  }
[Click to access protein entry]
 Spot: 662 (ob21dsub)
 pI: 6.77 Mw: 24000
 %vol: 0.0698607   %od: 0.098599
 ================
 *PSA2_RAT*
  accession n°: P17220

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HIGLVYSGMGPDYR;; $m/Z=GYSFSLTTFSPSGK;; $m/Z=RLTPTEVR;; $m/Z=LTPTEVR;; $m/Z=SILYDER;; $m/Z=KLAQQYYLVYQEPIPTAQLVQR;; $m/Z=LAQQYYLVYQEPIPTAQLVQR;; $m/Z=YNEDLELEDAIHTAILTLK;; $m/Z=LVQIEYALAAVAGGAPSVGIK;; $m/Z=HIGLVYSGMoxGPDYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 815.4218 (0), 895.4156 (0), 971.5226 (0),
  1478.7115 (0), 1564.7297 (0), 1580.7157 (0), 2027.1171 (0),
  2201.1003 (0), 2521.2991 (0), 2649.385 (0)
  }
[Click to access protein entry]
 Spot: 616 (ob21dsub)
 pI: 6.67 Mw: 28000
 %vol: 0.241274   %od: 0.210558
 ================
 *PGAM1_RAT*
  accession n°: P25113

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YADLTEDQLPSCcamESLKDTIAR;; $m/Z=SYDVPPPPMEPDHPFYSNISK;; $m/Z=TLWTVLDAIDQMoxWLPVVR;; $m/Z=TLWTVLDAIDQMWLPVVR;; $m/Z=FSGWYDADLSPAGHEEAKR;; $m/Z=FSGWYDADLSPAGHEEAK;; $m/Z=ALPFWNEEIVPQIK;; $m/Z=HGESAWNLENR;; $m/Z=HLEGLSEEAIMoxELNLPTGIPIVYELDK;; $m/Z=HLEGLSEEAIMELNLPTGIPIVYELDK;; $m/Z=RSYDVPPPPMEPDHPFYSNISK;; $m/Z=SYDVPPPPMoxEPDHPFYSNISK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1312.5845 (0), 1683.8792 (0), 2135.9531 (0),
  2156.1433 (0), 2172.1313 (0), 2417.0947 (0), 2425.136 (0),
  2433.0803 (0), 2573.1836 (0), 3023.5632 (0), 3039.5657 (0)
  }
[Click to access protein entry]
 Spot: 611 (ob21dsub)
 pI: 7.01 Mw: 28000
 %vol: 0.171117   %od: 0.172006
 ================
 *CAH2_RAT*
  accession n°: P27139

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=KLNFNSEGEAEELMoxVDNWRPAQPLK;; $m/Z=EGPLSGSYR;; $m/Z=IGPASQGLQK;; $m/Z=YAAELHLVHWNTK;; $m/Z=EPITVSSEQMSHFR;; $m/Z=AVQHPDGLAVLGIFLK;; $m/Z=LIQFHFHWGSSDGQGSEHTVNK;; $m/Z=SIVNNGHSFNVEFDDSQDFAVLK;; $m/Z=LIQFHFHWGSSDGQGSEHTVNKK;; $m/Z=LNFNSEGEAEELMVDNWRPAQPLK;; $m/Z=LNFNSEGEAEELMoxVDNWRPAQPLK;; $m/Z=QSPVDIDTGTAQHDPSLQPLLICcamYDK;; $m/Z=KLNFNSEGEAEELMVDNWRPAQPLK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 965.4586 (0), 998.5383 (0), 1581.7959 (0),
  1647.7571 (0), 1677.9481 (0), 2511.1606 (0), 2582.1936 (0),
  2639.2551 (0), 2787.3171 (0), 2803.3298 (0), 2911.4443 (0),
  2915.4194 (0), 2931.4143 (0) }
[Click to access protein entry]
 Spot: 741 (ob21dsub)
 pI: 5.91 Mw: 18000
 %vol: 0.06277   %od: 0.0517179
 ================
 *ARF1_RAT*
  accession n°: P84079

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=QDLPNAMoxNAAEITDKLGLHSLR;; $m/Z=DAVLLVFANK;; $m/Z=MoxLAEDELRDAVLLVFANK;; $m/Z=MLAEDELRDAVLLVFANK;; $m/Z=MLAEDELR;; $m/Z=VNEAREELMoxR;; $m/Z=HYFQNTQGLIFVVDSNDRER;; $m/Z=HYFQNTQGLIFVVDSNDR;; $m/Z=NISFTVWDVGGQDK;; $m/Z=LGEIVTTIPTIGFNVETVEYK;; $m/Z=ILMVGLDAAGK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 992.4487 (0), 1087.5693 (0), 1089.6008 (0),
  1262.5931 (0), 1565.7452 (0), 2047.0875 (0), 2063.0823 (0),
  2153.0432 (0), 2323.25 (0), 2423.2656 (0), 2438.1946 (0)
  }
[Click to access protein entry]
 Spot: 201 (ob21dsub)
 pI: 5.91 Mw: 75000
 %vol: 0.0912721   %od: 0.160291
 ================
 *DPYL2_RAT*
  accession n°: P47942

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VFNLYPR;; $m/Z=QIGENLIVPGGVK;; $m/Z=MoxVIPGGIDVHTR;; $m/Z=DRFQLTDSQIYEVLSVIR;; $m/Z=FQLTDSQIYEVLSVIR;; $m/Z=DIGAIAQVHAENGDIIAEEQQR;; $m/Z=ILDLGITGPEGHVLSRPEEVEAEAVNR;; $m/Z=SAAEVIAQAR;; $m/Z=DNFTLIPEGTNGTEER;; $m/Z=MoxDENQFVAVTSTNAAK;; $m/Z=ISVGSDADLVIWDPDSVK;; $m/Z=IVLEDGTLHVTEGSGR;; $m/Z=NLHQSGFSLSGAQIDDNIPR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 908.5301 (0), 1015.5901 (0), 1310.7189 (0),
  1323.7219 (0), 1682.9135 (0), 1741.87 (0), 1792.8945 (0),
  1911.072 (0), 1916.016 (0), 2169.1218 (0), 2182.2002 (0),
  2377.2346 (0), 2900.5759 (0) }
[Click to access protein entry]
 Spot: 281 (ob21dsub)
 pI: 5.94 Mw: 58000
 %vol: 0.105066   %od: 0.203775
 ================
 *DPYL3_RAT*
  accession n°: Q62952

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MoxVMoxPGGIDVHTHFQMoxPYK;; $m/Z=IVNDDQSFYADIYMoxEDGLIK;; $m/Z=GNVVFGEPITASLGIDGTHYWSK;; $m/Z=AALAGGTTMoxIIDHVVPEPESSLTEAYEK;; $m/Z=MoxLEMoxGITGPEGHVLSRPEELEAEAVFR;; $m/Z=SAADLISQAR;; $m/Z=QIGDNLIVPGGVK;; $m/Z=GVNSFMoxVYMoxAYK;; $m/Z=GMoxTTVDDFFQGTK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1031.5582 (0), 1309.722 (0), 1441.6477 (0),
  1462.6586 (0), 2135.9836 (0), 2365.1111 (0), 2448.2378 (0),
  2945.4651 (0), 3029.5049 (0) }
[Click to access protein entry]
 Spot: 784 (ob21dsub)
 pI: 6.36 Mw: 59000
 %vol: 0.0732727   %od: 0.187035
 ================
 *PGM1_RAT*
  accession n°: P38652

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FYMoxTEAIQLIVR;; $m/Z=LIFADGSR;; $m/Z=SGEHDFGAAFDGDGDR;; $m/Z=LSLCGEESFGTGSDHIR;; $m/Z=ELLSGPNR;; $m/Z=NIFDFNALK;; $m/Z=TIEEYAICPDLK;; $m/Z=LVIGQNGILSTPAVSCIIR;; $m/Z=TQAYPDQKPGTSGLR;; $m/Z=VFQGNANYAENFIQSIVSTVEPALR;; $m/Z=QEATLVVGGDGR;; $m/Z=FYMTEAIQLIVR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 878.4334 (0), 885.4372 (0), 1081.5339 (0),
  1201.5923 (0), 1451.734 (0), 1483.7716 (0), 1499.7639 (0),
  1618.8004 (0), 1652.6388 (0), 1864.8389 (0), 2011.1212 (0),
  2767.3975 (0) }
[Click to access protein entry]
 Spot: 696 (ob21dsub)
 pI: 5.89 Mw: 21000
 %vol: 0.122207   %od: 0.172041
 ================
 *ATP5H_RAT*
  accession n°: P31399

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LASLSEKPPAIDWAYYR;; $m/Z=SWNETFHTR;; $m/Z=NCcamAQFVTGSQAR;; $m/Z=YPYWPHQPIENL;; $m/Z=KYPYWPHQPIENL;; $m/Z=TIDWVSFVEIMoxPQNQK;; $m/Z=NMoxIPFDQMoxTIDDLNEVFPETK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1177.5032 (0), 1338.5941 (0), 1556.7095 (0),
  1684.8046 (0), 1950.9288 (0), 1979.974 (0), 2529.1213 (0)
  }
[Click to access protein entry]
 Spot: 448 (ob21dsub)
 pI: 8.52 Mw: 44000
 %vol: 0.202335   %od: 0.150441
 ================
 *ALDOA_RAT*
  accession n°: P05065

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VNPCcamIGGVILFHETLYQK;; $m/Z=QLLLTADDR;; $m/Z=DGADFAKWR;; $m/Z=AAQEEYIKR;; $m/Z=ADDGRPFPQVIK;; $m/Z=PHPYPALTPEQK;; $m/Z=LQSIGTENTEENRR;; $m/Z=FSNEEIAMoxATVTALR;; $m/Z=CcamPLLKPWALTFSYGR;; $m/Z=FSNEEIAMoxATVTALRR;; $m/Z=ELADIAHR;; $m/Z=IGEHTPSSLAIMENANVLAR;; $m/Z=IGEHTPSSLAIMoxENANVLAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 924.5009 (0), 1044.5784 (0), 1065.5417 (0),
  1107.5931 (0), 1342.7314 (0), 1377.7305 (0), 1646.8387 (0),
  1668.8552 (0), 1808.9794 (0), 1824.9773 (0), 2088.1343 (0),
  2123.1328 (0), 2139.1245 (0) }
[Click to access protein entry]
 Spot: 141 (ob21dsub)
 pI: 5.03 Mw: 87000
 %vol: 0.373063   %od: 0.21858
 ================
 *HS90B_RAT*
  accession n°: P34058

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HLEINPDHPIVETLR;; $m/Z=HSQFIGYPITLYLEK;; $m/Z=NPDDITQEEYGEFYK;; $m/Z=KHLEINPDHPIVETLR;; $m/Z=YHTSQSGDEMTSLSEYVSR;; $m/Z=YHTSQSGDEMoxTSLSEYVSR;; $m/Z=HNDDEQYAWESSAGGSFTVR;; $m/Z=GVVDSEDLPLNISREMoxLQQSK;; $m/Z=LGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASR;; $m/Z=ALLFIPR;; $m/Z=RAPFDLFENK;; $m/Z=EQVANSAFVER;; $m/Z=EDQTEYLEER;; $m/Z=HFSVEGQLEFR;; $m/Z=GVVDSEDLPLNISR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 829.5377 (0), 1236.6331 (0), 1249.6566 (0),
  1311.5626 (0), 1348.6766 (0), 1513.7765 (0), 1782.9459 (0),
  1808.941 (0), 1847.7686 (0), 1911.0182 (0), 2176.9458 (0),
  2192.939 (0), 2255.9634 (0), 2374.156 (0), 3535.6631 (0)
  }
[Click to access protein entry]
 Spot: 468 (ob21dsub)
 pI: 5.46 Mw: 42000
 %vol: 0.0324222   %od: 0.111493
 ================
 *GNAQ_RAT*
  accession n°: P82471

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YYLNDLDR;; $m/Z=RINDEIER;; $m/Z=INDEIER;; $m/Z=IIHGSGYSDEDKR;; $m/Z=VSAFENPYVDAIK;; $m/Z=VADPSYLPTQQDVLR;; $m/Z=VPTTGIIEYPFDLQSVIFR;; $m/Z=MoxVDVGGQR;; $m/Z=IMoxYSHLVDYFPEYDGPQR;; $m/Z=IIYSHFTCATDTENIR;; $m/Z=DTILQLNLK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 877.4494 (0), 888.4853 (0), 1044.5792 (0),
  1057.6339 (0), 1071.5564 (0), 1452.7649 (0), 1476.7727 (0),
  1701.9218 (0), 1940.9647 (0), 2195.2202 (0), 2246.0542 (0)
  }
[Click to access protein entry]
 Spot: 329 (ob21dsub)
 pI: 5.95 Mw: 52000
 %vol: 0.104462   %od: 0.168278
 ================
 *TCPB_RAT*
  accession n°: Q5XIM9

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=QVLLSAAEAAEVILR;; $m/Z=MoxLPTIIADNAGYDSADLVAQLR;; $m/Z=SLHDALCVLAQTVK;; $m/Z=GATQQILDEAER;; $m/Z=LALVTGGEIASTFDHPELVK;; $m/Z=LAVEAVLR;; $m/Z=LGGSLADSYLDEGFLLDKK;; $m/Z=HGINCFINR;; $m/Z=LSSFIGAIAIGDLVK;; $m/Z=STLGPKGMDK;; $m/Z=VQDDEVGDGTTSVTVLAAELLR;; $m/Z=KIHPQTIIAGWR;; $m/Z=IHPQTIIAGWR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 870.5421 (0), 1033.5317 (0), 1130.5616 (0),
  1291.7229 (0), 1330.6589 (0), 1419.8165 (0), 1503.8453 (0),
  1554.7937 (0), 1582.9037 (0), 2040.9905 (0), 2097.0674 (0),
  2288.1035 (0), 2363.1218 (0) }
[Click to access protein entry]
 Spot: 620 (ob21dsub)
 pI: 5.59 Mw: 28000
 %vol: 0.031196   %od: 0.0701919
 ================
 *6PGL_RAT*
  accession n°: P85971

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FALGLSGGSLVSMoxLAR;; $m/Z=DLPAATAPAGPASFAR;; $m/Z=LVPFDHAESTYGLYR;; $m/Z=LPIPDSQVLTIDPALPVEDAAEDYAR;; $m/Z=EKIVAPIGDSPKPPPQR;; $m/Z=IVAPIGDSPKPPPQR;; $m/Z=ILEDQESALPAAMoxVQPR;; $m/Z=LLSVPFEK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 932.5712 (0), 1512.849 (0), 1571.9576 (0),
  1594.9155 (0), 1767.9415 (0), 1829.0862 (0), 1884.0077 (0),
  2808.4756 (0) }
[Click to access protein entry]
 Spot: 68 (ob21dsub)
 pI: 4.77 Mw: 95000
 %vol: 0.122593   %od: 0.127979
 ================
 *NFM_RAT*
  accession n°: P12839

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HNHDLSSYQDTIQQLENELR;; $m/Z=FSTFSGSITGPLYTHR;; $m/Z=FVEEIIEETKVEDEK;; $m/Z=DTKEEKPQQQEK;; $m/Z=EIEAEIHALR;; $m/Z=QASHAQLGDAYDQEIR;; $m/Z=ELRATLEMoxVNHEK;; $m/Z=AQVQLDSDHLEEDIHR;; $m/Z=DIEESSMVKVELDK;; $m/Z=VQSLQDEVAFLR;; $m/Z=SNHEEEVADLLAQIQASHITVER;; $m/Z=DYLKTDISTALK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1180.6764 (0), 1367.7701 (0), 1404.7961 (0),
  1487.7803 (0), 1585.8251 (0), 1621.8644 (0), 1770.9343 (0),
  1801.9138 (0), 1836.9954 (0), 1904.98 (0), 2440.2043 (0),
  2589.3408 (0) }
[Click to access protein entry]
 Spot: 414 (ob21dsub)
 pI: 5.95 Mw: 46000
 %vol: 0.141712   %od: 0.205308
 ================
 *SAHH_RAT*
  accession n°: P10760

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=WSSCNIFSTQDHAAAAIAK;; $m/Z=HPQLLSGIR;; $m/Z=GISEETTTGVHNLYK;; $m/Z=SKFDNLYGCR;; $m/Z=FDNLYGCR;; $m/Z=EGNIFVTTTGCVDIILGR;; $m/Z=WLNENAVEK;; $m/Z=VNIKPQVDR;; $m/Z=QAQYLGMoxPINGPFKPDHYR;; $m/Z=QAQYLGMPINGPFKPDHYR;; $m/Z=IILLAEGR;; $m/Z=YPVGVHFLPK;; $m/Z=VADIGLAAWGR;; $m/Z=ALDIAENEMPGLMR;; $m/Z=ALDIAENEMoxPGLMR;; $m/Z=ALDIAENEMoxPGLMoxR;; $m/Z=AGIPVFAWK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 884.5436 (0), 988.5424 (0), 1020.585 (0),
  1044.4486 (0), 1068.6034 (0), 1102.541 (0), 1128.6093 (0),
  1156.6279 (0), 1259.578 (0), 1559.7488 (0), 1575.7341 (0),
  1591.7214 (0), 1648.798 (0), 1964.9951 (0), 2077.9478 (0),
  2232.0708 (0), 2248.0618 (0) }
[Click to access protein entry]
 Spot: 575 (ob21dsub)
 pI: 8.70 Mw: 32000
 %vol: 0.422486   %od: 0.205061
 ================
 *ATPG_RAT*
  accession n°: P35435

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VYGTGSLALYEK;; $m/Z=HLIIGVSSDR;; $m/Z=EVMoxIVGIGEK;; $m/Z=THSDQFLVSFK;; $m/Z=ESTTSEQSAR;; $m/Z=NASDMoxIDKLTLTFNR;; $m/Z=LTLTFNR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 864.5059 (0), 1090.5708 (0), 1095.5406 (0),
  1096.6254 (0), 1300.6643 (0), 1308.6533 (0), 1754.8564 (0)
  }
[Click to access protein entry]
 Spot: 246 (ob21dsub)
 pI: 6.94 Mw: 61000
 %vol: 0.164225   %od: 0.191766
 ================
 *DPYL5_RAT*
  accession n°: Q9JHU0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SFPDIVYK;; $m/Z=DLHESSFSLSGSQIDDHVPKR;; $m/Z=THCPIYLVNVSSISAGDVIAAAK;; $m/Z=LDTNTSTYLMoxSLLANDTLNIVASDHRPFTTK;; $m/Z=MoxSVVWER;; $m/Z=ILNLYPR;; $m/Z=TISASTQVQGGDFNLYENMoxR;; $m/Z=CHGVPLVTISR;; $m/Z=DLHESSFSLSGSQIDDHVPK;; $m/Z=VVNDDCTHEADVYIENGIIQQVGR;; $m/Z=AEMoxETLVREK;; $m/Z=GVNSFQMoxFMoxTYK;; $m/Z=DLYMoxLR;; $m/Z=DSELYQVFHACR;; $m/Z=EALDLGITGPEGIEISHPEELEAEATHR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 826.4106 (0), 888.5378 (0), 922.4764 (0), 968.5104 (0),
  1221.6564 (0), 1238.6639 (0), 1484.6785 (0), 1524.704 (0),
  2198.0605 (0), 2247.0422 (0), 2354.1355 (0), 2386.2368 (0),
  2744.304 (0), 3013.478 (0), 3468.7356 (0)
  }
[Click to access protein entry]
 Spot: 162 (ob21dsub)
 pI: 6.59 Mw: 82000
 %vol: 0.153982   %od: 0.185242
 ================
 *TRFE_RAT*
  accession n°: P12346

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ASDSSINWNNLK;; $m/Z=TAGWNIPMoxGLLFSR;; $m/Z=FDEFFSQGCAPGYK;; $m/Z=EGYNGYTGAFQCLVEK;; $m/Z=KPVTEFATCHLAQAPNHVVVSR;; $m/Z=GDKDCTGNFCLFR;; $m/Z=DCTGNFCLFR;; $m/Z=LPEGTTYEEYLGAEYLQAVGNIR;; $m/Z=LLEACTFHK;; $m/Z=LYLGHSYVTAIR;; $m/Z=DSAFGCYGVPPRMoxDYR;; $m/Z=DFQLFGSPLGK;; $m/Z=SKDFQLFGSPLGK;; $m/Z=VAQEHFGK;; $m/Z=IPSHAVVAR;; $m/Z=KPVDQYEDCYLAR;; $m/Z=DQYELLCLDNTR;; $m/Z=ADRDQYELLCLDNTR;; $m/Z=HTTIFEVLPQK;; $m/Z=KTSYQDCIK;; $m/Z=TVLPADGPR;; $m/Z=WCALSHQER }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 915.4532 (0), 925.5033 (0), 949.5486 (0),
  1118.5476 (0), 1142.588 (0), 1186.5372 (0), 1208.5933 (0),
  1289.5356 (0), 1312.6899 (0), 1348.6362 (0), 1392.7465 (0),
  1423.722 (0), 1539.6918 (0), 1578.7736 (0), 1589.6641 (0),
  1652.6705 (0), 1656.7419 (0), 1835.7958 (0), 1881.8354 (0),
  1906.8704 (0), 2461.2178 (0), 2586.2073 (0)
  }
[Click to access protein entry]
 Spot: 130 (ob21dsub)
 pI: 6.41 Mw: 95000
 %vol: 0.084391   %od: 0.166225
 ================
 *EF2_RAT*
  accession n°: P05197

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=CcamLYASVLTAQPR;; $m/Z=KEDLYLKPIQR;; $m/Z=IKPVLMMNKMDR;; $m/Z=TGTITTFEHAHNMoxR;; $m/Z=ANIRNMSVIAHVDHGK;; $m/Z=GHVFEESQVAGTPMoxFVVK;; $m/Z=RGHVFEESQVAGTPMoxFVVK;; $m/Z=ARPFPDGLAEDIDKGEVSAR;; $m/Z=DSVVAGFQWATK;; $m/Z=EDLYLKPIQR;; $m/Z=AGETRFTDTR;; $m/Z=YEWDVAEAR;; $m/Z=VFDAIMoxNFR;; $m/Z=VNFTVDQIR;; $m/Z=GVQYLNEIK;; $m/Z=GEGQLGAAER;; $m/Z=GGGQIIPTAR;; $m/Z=SDPVVSYR;; $m/Z=FSVSPVVR;; $m/Z=TILMoxMoxGR;; $m/Z=ARPFPDGLAEDIDK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 853.4622 (0), 890.5524 (0), 922.5071 (0), 969.597 (0),
  987.538 (0), 1063.6216 (0), 1091.6382 (0), 1128.6011 (0),
  1138.5736 (0), 1153.6212 (0), 1274.7737 (0), 1308.7137 (0),
  1378.7732 (0), 1402.8751 (0), 1475.8164 (0), 1543.8475 (0),
  1631.8374 (0), 1761.889 (0), 1978.0598 (0), 2134.1802 (0),
  2143.179 (0) }
[Click to access protein entry]
 Spot: 532 (ob21dsub)
 pI: 5.38 Mw: 37000
 %vol: 0.072531   %od: 0.181844
 ================
 *ODPB_RAT*
  accession n°: P49432

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TYYMSAGLQPVPIVFR;; $m/Z=TYYMoxSAGLQPVPIVFR;; $m/Z=DFLIPIGK;; $m/Z=TIRPMoxDIEAIEASVMoxK;; $m/Z=EAINQGMoxDEELERDEK;; $m/Z=TNHLVTVEGGWPQFGVGAEICAR;; $m/Z=IMoxEGPAFNFLDAPAVR;; $m/Z=VFLLGEEVAQYDGAYK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 902.5391 (0), 1763.8929 (0), 1801.9102 (0),
  1835.9366 (0), 1841.9619 (0), 1857.9669 (0), 1921.859 (0),
  2498.2397 (0) }
[Click to access protein entry]
 Spot: 557 (ob21dsub)
 pI: 5.52 Mw: 33000
 %vol: 0.0748609   %od: 0.181844
 ================
 *CAPZB_RAT*
  accession n°: Q5XI32

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SPWSNKYDPPLEDGAMoxPSAR;; $m/Z=RLPPQQIEK;; $m/Z=LPPQQIEK;; $m/Z=DYLLCDYNR;; $m/Z=YDPPLEDGAMoxPSAR;; $m/Z=KLEVEANNAFDQYR;; $m/Z=LEVEANNAFDQYR;; $m/Z=GCWDSIHVVEVQEK;; $m/Z=LTSTVMoxLWLQTNK;; $m/Z=SGSGTMoxNLGGSLTR;; $m/Z=QMoxEKDETVSDCSPHIANIGR;; $m/Z=DETVSDCSPHIANIGR;; $m/Z=LVEDMoxENKIR;; $m/Z=STLNEIYFGK;; $m/Z=NDLVEALKR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 952.5659 (0), 1057.6172 (0), 1108.6852 (0),
  1171.6312 (0), 1231.5957 (0), 1262.6747 (0), 1353.6862 (0),
  1534.7296 (0), 1550.8232 (0), 1568.7946 (0), 1685.8378 (0),
  1696.8901 (0), 1770.8809 (0), 2234.0725 (0), 2303.0701 (0)
  }
[Click to access protein entry]
 Spot: 235 (ob21dsub)
 pI: 4.70 Mw: 66000
 %vol: 0.0802916   %od: 0.172076
 ================
 *NFL_RAT*
  accession n°: P19527

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=RIDSLMoxDEIAFLK;; $m/Z=SAYSGLQSSSYLMoxSAR;; $m/Z=SAYSSYSAPVSSSLSVR;; $m/Z=GMoxNEALEKQLQELEDK;; $m/Z=AQLQDLNDRFASFIER;; $m/Z=LSFTSVGSITSGYSQSSQVFGR;; $m/Z=AFPAYYTSHVQEEQSEVEETIEATK;; $m/Z=VLEAELLVLR;; $m/Z=AQLQDLNDR;; $m/Z=YEEEVLSR;; $m/Z=ALYEQEIR;; $m/Z=TLEIEACcamR;; $m/Z=LLEGEETR;; $m/Z=FASFIER;; $m/Z=DEVSESR;; $m/Z=QALQGER;; $m/Z=SIRTQEK;; $m/Z=IDSLMDEIAFLK;; $m/Z=RIDSLMDEIAFLK;; $m/Z=MoxALDIEIAAYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 801.4151 (0), 821.3862 (0), 861.4639 (0), 869.4324 (0),
  946.4728 (0), 991.5032 (0), 1021.5176 (0), 1024.4858 (0),
  1072.5314 (0), 1154.7002 (0), 1281.6412 (0), 1394.723 (0),
  1550.8129 (0), 1566.8074 (0), 1723.7932 (0), 1747.8363 (0),
  1890.9288 (0), 1922.9653 (0), 2295.1113 (0), 2886.3333 (0)
  }
[Click to access protein entry]
 Spot: 594 (ob21dsub)
 pI: 5.86 Mw: 30000
 %vol: 0.0508825   %od: 0.13471
 ================
 *PHB_RAT*
  accession n°: P67779

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FDAGELITQR;; $m/Z=ELVSRQVSDDLTER;; $m/Z=AATFGLILDDVSLTHLTFGK;; $m/Z=QVAQQEAER;; $m/Z=AAELIANSLATAGDGLIELR;; $m/Z=KLEAAEDIAYQLSR;; $m/Z=LEAAEDIAYQLSR;; $m/Z=VLPSITTEILK;; $m/Z=IYTSIGEDYDER;; $m/Z=ILFRPVASQLPR;; $m/Z=DLQNVNITLR;; $m/Z=FGLALAVAGGVVNSALYNVDAGHR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1058.5677 (0), 1149.6353 (0), 1185.7047 (0),
  1213.7358 (0), 1396.8964 (0), 1460.7131 (0), 1478.8015 (0),
  1606.9052 (0), 1646.8737 (0), 1998.1489 (0), 2119.1797 (0),
  2371.3203 (0) }
[Click to access protein entry]
 Spot: 174 (ob21dsub)
 pI: 5.91 Mw: 81000
 %vol: 0.0601251   %od: 0.200248
 ================
 *EZRI_RAT*
  accession n°: P31977

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=IQVWHAEHR;; $m/Z=IAQDLEMoxYGINYFEIK;; $m/Z=IGFPWSEIR;; $m/Z=KAPDFVFYAPR;; $m/Z=APDFVFYAPR;; $m/Z=ILQLCMoxGNHELYMoxR;; $m/Z=RKPDTIEVQQMoxK;; $m/Z=EDEVEEWQHR;; $m/Z=QLLTLSNELSQAR;; $m/Z=THNDIIHNENMoxR;; $m/Z=KPDTIEVQQMK;; $m/Z=EKEELMoxLR;; $m/Z=LQDFEQKTK;; $m/Z=ALQLEEER;; $m/Z=SQEQLAAELAEYTAK;; $m/Z=IALLEEAR;; $m/Z=KEDEVEEWQHR;; $m/Z=PKPINVR;; $m/Z=QLFDQVVK;; $m/Z=EVWYFGLQYVDNK;; $m/Z=FYPEDVADELIQDITQK;; $m/Z=LFFLQVK;; $m/Z=SGYLSSER }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 823.5161 (0), 894.5466 (0), 898.4331 (0), 914.5358 (0),
  976.548 (0), 987.5197 (0), 1063.5494 (0), 1104.5913 (0),
  1136.5809 (0), 1175.6139 (0), 1182.5989 (0), 1310.6937 (0),
  1316.6827 (0), 1356.588 (0), 1472.809 (0), 1484.6821 (0),
  1488.774 (0), 1509.6934 (0), 1651.8086 (0), 1660.7944 (0),
  1809.8372 (0), 1962.9371 (0), 2023.9563 (0)
  }
[Click to access protein entry]
 Spot: 758 (ob21dsub)
 pI: 4.71 Mw: 18000
 %vol: 0.106816   %od: 0.113693
 ================
 *SYUA_RAT*
  accession n°: P37377

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=QGVAEAAGK;; $m/Z=EGVVAAAEK;; $m/Z=EGVLYVGSKTK;; $m/Z=EGVVHGVTTVAEK;; $m/Z=TVEGAGNIAAATGFVK;; $m/Z=EGVVHGVTTVAEKTK;; $m/Z=EQVTNVGGAVVTGVTAVAQK;; $m/Z=TKEQVTNVGGAVVTGVTAVAQK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 830.4578 (0), 873.5077 (0), 1180.6892 (0),
  1325.7639 (0), 1505.861 (0), 1554.9155 (0), 1928.1191 (0),
  2157.2715 (0) }
[Click to access protein entry]
 Spot: 396 (ob21dsub)
 pI: 6.34 Mw: 48000
 %vol: 0.0634746   %od: 0.162309
 ================
 *EFTU_RAT*
  accession n°: P85834

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GITINAAHVEYSTAAR;; $m/Z=YEEIDNAPEER;; $m/Z=GTVVTGTLER;; $m/Z=AEAGDNLGALVR;; $m/Z=QIGVEHVVVYVNK;; $m/Z=LLDAVDTYIPVPTR;; $m/Z=GEETPVIVGSALCcamALEQR;; $m/Z=ADAVQDSEMVELVELEIR;; $m/Z=ADAVQDSEMoxVELVELEIR;; $m/Z=DLEKPFLLPVESVYSIPGR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1032.5571 (0), 1185.6208 (0), 1364.597 (0),
  1483.8262 (0), 1572.8665 (0), 1673.9202 (0), 1928.9847 (0),
  2046.0155 (0), 2062.0149 (0), 2159.1873 (0)
  }
[Click to access protein entry]
 Spot: 736 (ob21dsub)
 pI: 6.36 Mw: 19000
 %vol: 0.0861715   %od: 0.0629368
 ================
 *ARF3_RAT*
  accession n°: P61206

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NISFTVWDVGGQDK;; $m/Z=HYFQNTQGLIFVVDSNDR;; $m/Z=HYFQNTQGLIFVVDSNDRER;; $m/Z=MoxLAEDELR;; $m/Z=MoxLAEDELRDAVLLVFANK;; $m/Z=DAVLLVFANK;; $m/Z=LGEIVTTIPTIGFNVETVEYK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 992.4551 (0), 1089.5975 (0), 1565.7081 (0),
  2063.0056 (0), 2153 (0), 2323.1467 (0), 2438.1174 (0)
  }
[Click to access protein entry]
 Spot: 220 (ob21dsub)
 pI: 5.77 Mw: 67000
 %vol: 0.222216   %od: 0.18648
 ================
 *ALBU_RAT*
  accession n°: P02770

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FKDLGEQHFK;; $m/Z=LVQEVTDFAK;; $m/Z=RHPYFYAPELLYYAEK;; $m/Z=HPYFYAPELLYYAEK;; $m/Z=FPNAEFAEITK;; $m/Z=DVFLGTFLYEYSR;; $m/Z=RHPDYSVSLLLR;; $m/Z=HPDYSVSLLLR;; $m/Z=LGEYGFQNAVLVR;; $m/Z=LPCVEDYLSAILNR;; $m/Z=RPCFSALTVDETYVPK;; $m/Z=MoxKWVTFLLLLFISGSAFSR;; $m/Z=AADKDNCFATEGPNLVAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1149.627 (0), 1248.6575 (0), 1266.657 (0),
  1299.7312 (0), 1455.8341 (0), 1465.8109 (0), 1609.8259 (0),
  1662.8868 (0), 1882.9701 (0), 1903.9564 (0), 1948.9623 (0),
  2060.0669 (0), 2232.1274 (0) }
[Click to access protein entry]
 Spot: 447 (ob21dsub)
 pI: 7.28 Mw: 44000
 %vol: 0.082627   %od: 0.1463
 ================
 *IDH3B_RAT*
  accession n°: Q68FX0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SVIGHLHPHGG;; $m/Z=HLNLEYHSSMoxIADAVK;; $m/Z=NIANPTAMoxLLSASNMoxLR;; $m/Z=FAFDYATK;; $m/Z=EQTEGEYSSLEHESAR;; $m/Z=HNNLDLVIIR;; $m/Z=TRHNNLDLVIIR;; $m/Z=LDLFANVVHVK;; $m/Z=KLDLFANVVHVK;; $m/Z=GELASYDMoxQLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 962.5051 (0), 1110.6272 (0), 1206.7496 (0),
  1254.7397 (0), 1298.6492 (0), 1382.8544 (0), 1463.8922 (0),
  1843.9452 (0), 1848.9666 (0), 1851.8551 (0)
  }
[Click to access protein entry]
 Spot: 120 (ob21dsub)
 pI: 4.84 Mw: 95000
 %vol: 0.157969   %od: 0.203527
 ================
 *ENPL_RAT*
  accession n°: Q66HD0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ESDDPMoxAYIHFTAEGEVTFK;; $m/Z=TDDEVVQREEEAIQLDGLNASQIR;; $m/Z=EEEAIQLDGLNASQIR;; $m/Z=FAFQAEVNR;; $m/Z=LIINSLYK;; $m/Z=NKEIFLR;; $m/Z=ELISNASDALDKIR;; $m/Z=LISLTDENALAGNEELTVK;; $m/Z=EKNLLHVTDTGVGMTR;; $m/Z=NLLHVTDTGVGMoxTR;; $m/Z=EEASDYLELDTIK;; $m/Z=SILFVPTSAPR;; $m/Z=GLFDEYGSK;; $m/Z=GLFDEYGSKK;; $m/Z=RVFITDDFHDMoxMoxPK;; $m/Z=VFITDDFHDMoxMoxPK;; $m/Z=GVVDSDDLPLNVSR;; $m/Z=LGVIEDHSNR;; $m/Z=FQSSHHSTDITSLDQYVER;; $m/Z=IYFMAGSSR;; $m/Z=IYFMoxAGSSR;; $m/Z=KEAESSPFVER;; $m/Z=EAESSPFVER;; $m/Z=DISTNYYASQK;; $m/Z=KTFEINPR;; $m/Z=TFEINPR;; $m/Z=TVMoxDLAVVLFETATLR;; $m/Z=TVMDLAVVLFETATLRSGYLLPDTK;; $m/Z=SGYLLPDTK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 876.4638 (0), 919.5421 (0), 963.5746 (0), 993.5281 (0),
  1004.5663 (0), 1015.4807 (0), 1031.5198 (0), 1047.502 (0),
  1081.5553 (0), 1139.5962 (0), 1143.5845 (0), 1150.5559 (0),
  1187.6896 (0), 1278.668 (0), 1289.6298 (0), 1485.7644 (0),
  1525.744 (0), 1529.7728 (0), 1544.832 (0), 1627.7152 (0),
  1770.8921 (0), 1783.816 (0), 1785.8799 (0), 1794.91 (0),
  2030.0598 (0), 2250.0476 (0), 2303.0195 (0), 2728.3398 (0),
  2753.3896 (0) }
[Click to access protein entry]
 Spot: 230 (ob21dsub)
 pI: 5.94 Mw: 68000
 %vol: 0.0450555   %od: 0.157861
 ================
 *DHSA_RAT*
  accession n°: Q920L2

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VTLDYRPVIDK;; $m/Z=IDEYDYSKPIEGQQK;; $m/Z=TLNEADCATVPPAIR;; $m/Z=KPFAEHWR;; $m/Z=VRIDEYDYSKPIEGQQK;; $m/Z=VSDAISTQYPVVDHEFDAVVVGAGGAGLR;; $m/Z=WHFYDTVK;; $m/Z=TGHSLLHTLYGR;; $m/Z=GVIALCIEDGSIHR;; $m/Z=NTIIATGGYGR;; $m/Z=GEGGILINSQGER;; $m/Z=GCGPEKDHVYLQLHHLPPEQLATR;; $m/Z=VSQLYGDLQHLK;; $m/Z=SMoxQSHAAVFR;; $m/Z=ANAGEESVMoxNLDKLR;; $m/Z=LGANSLLDLVVFGR;; $m/Z=DHVYLQLHHLPPEQLATR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1070.5393 (0), 1095.5028 (0), 1122.5731 (0),
  1149.5483 (0), 1318.6954 (0), 1329.6569 (0), 1354.6967 (0),
  1400.7019 (0), 1473.8116 (0), 1539.7579 (0), 1627.7751 (0),
  1662.8153 (0), 1812.8003 (0), 2068.0022 (0), 2167.0786 (0),
  2795.311 (0), 2929.3752 (0) }
[Click to access protein entry]
 Spot: 633 (ob21dsub)
 pI: 6.67 Mw: 26000
 %vol: 0.186704   %od: 0.149414
 ================
 *TPIS_RAT*
  accession n°: P48500

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=RHIFGESDELIGQK;; $m/Z=CcamLGELICcamTLNAAK;; $m/Z=IAVAAQNCcamYK;; $m/Z=KFFVGGNWK;; $m/Z=FFVGGNWK;; $m/Z=CcamNVSEGVAQCcamTR;; $m/Z=ELASQPDVDGFLVGGASLKPEFVDIINAK;; $m/Z=LPADTEVVCcamAPPTAYIDFAR;; $m/Z=HIFGESDELIGQK;; $m/Z=DLGATWVVLGHSER;; $m/Z=VVLAYEPVWAIGTGK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 954.4616 (0), 1082.5586 (0), 1137.5415 (0),
  1380.5651 (0), 1462.6901 (0), 1472.6903 (0), 1539.7443 (0),
  1602.8314 (0), 1628.786 (0), 2206.0098 (0), 3029.4861 (0)
  }
[Click to access protein entry]
 Spot: 63 (ob21dsub)
 pI: 5.89 Mw: 118000
 %vol: 0.0477841   %od: 0.14945
 ================
 *LPPRC_RAT*
  accession n°: Q5SGE0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LQWFCDR;; $m/Z=AALDLEQVPSELAVTR;; $m/Z=TLLELIPELR;; $m/Z=SGSQFDWALMoxR;; $m/Z=VFESTCR;; $m/Z=SGSPGSNQALLLLR;; $m/Z=SCGSLLPELSLAER;; $m/Z=VYLQNEYR;; $m/Z=DLPITEAVFSALVTGHAR;; $m/Z=AGYPQYVSEILEK;; $m/Z=AVMoxEALRDEGFPIR;; $m/Z=GSLILGFR;; $m/Z=RSMoxNIDLWSK;; $m/Z=SMoxNIDLWSK;; $m/Z=QYFHQLR;; $m/Z=VQDAINILKEMoxK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 862.4833 (0), 898.4424 (0), 991.498 (0), 1024.4709 (0),
  1084.5353 (0), 1109.5349 (0), 1196.6887 (0), 1265.6279 (0),
  1313.5798 (0), 1412.757 (0), 1417.7157 (0), 1496.712 (0),
  1531.7563 (0), 1619.7697 (0), 1711.8882 (0), 1896.9769 (0)
  }
[Click to access protein entry]
 Spot: 365 (ob21dsub)
 pI: 5.97 Mw: 50000
 %vol: 0.308156   %od: 0.287498
 ================
 *ENOA_RAT*
  accession n°: P04764

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YNQILR;; $m/Z=FGANAILGVSLAVCcamK;; $m/Z=LAQSNGWGVMVSHR;; $m/Z=AAVPSGASTGIYEALELR;; $m/Z=LAMQEFMILPVGASSFR;; $m/Z=LAMoxQEFMILPVGASSFR;; $m/Z=LAMoxQEFMoxILPVGASSFR;; $m/Z=FTATAGIQVVGDDLTVTNPK;; $m/Z=AGYTDQVVIGMDVAASEFYR;; $m/Z=AGYTDQVVIGMoxDVAASEFYR;; $m/Z=SGETEDTFIADLVVGLCcamTGQIK;; $m/Z=DYPVVSIEDPFDQDDWDAWQK;; $m/Z=HIADLAGNPEVILPVPAFNVINGGSHAGNK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 806.4219 (0), 1519.8 (0), 1541.7659 (0), 1804.9152 (0),
  1896.9463 (0), 1912.9442 (0), 1928.9362 (0), 2047.0371 (0),
  2192.0044 (0), 2208.0068 (0), 2353.1257 (0), 2568.0989 (0),
  3021.5627 (0) }
[Click to access protein entry]
 Spot: 266 (ob21dsub)
 pI: 5.38 Mw: 59000
 %vol: 0.268703   %od: 0.232206
 ================
 *HNRPK_RAT*
  accession n°: P61980

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=IITITGTQDQIQNAQYLLQNSVK;; $m/Z=IDEPLEGSEDR;; $m/Z=GSYGDLGGPIITTQVTIPK;; $m/Z=GGDLMoxAYDR;; $m/Z=NLPLPPPPPPR;; $m/Z=GPPPPPPGR;; $m/Z=IILDLISESPIK;; $m/Z=VVLIGGKPDR;; $m/Z=LFQECCPHSTDR;; $m/Z=LLIHQSLAGGIIGVK;; $m/Z=GSDFDCELR;; $m/Z=ILSISADIETIGEILK;; $m/Z=TDYNASVSVPDSSGPER;; $m/Z=RPAEDMoxEEEQAFK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 871.4616 (0), 1013.4491 (0), 1053.6583 (0),
  1098.4612 (0), 1194.7118 (0), 1259.5946 (0), 1340.8013 (0),
  1518.9369 (0), 1549.6675 (0), 1595.7062 (0), 1714.9777 (0),
  1780.8043 (0), 1917.024 (0), 2589.3696 (0)
  }
[Click to access protein entry]
 Spot: 53 (ob21dsub)
 pI: 5.35 Mw: 135000
 %vol: 0.0982521   %od: 0.159631
 ================
 *HYOU1_RAT*
  accession n°: Q63617

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MoxGPYPQR;; $m/Z=YSHDFNFHINYGDLGFLGPEDLR;; $m/Z=VESVFETLVEDSPEEESTLTK;; $m/Z=GQAGPEGVPPAPEEEKK;; $m/Z=LEDLTLR;; $m/Z=AANSLEAFIFETQDK;; $m/Z=LYQPEYQEVSTEEQR;; $m/Z=LYQPEYQEVSTEEQREEISGK;; $m/Z=KLCQGLFFR;; $m/Z=LCQGLFFR;; $m/Z=TEPPLNASAGDQEEK;; $m/Z=VLQLINDNTATALSYGVFR;; $m/Z=DAVITVPAFFNQAER;; $m/Z=SLAEDFAEQPIKDAVITVPAFFNQAER;; $m/Z=SLAEDFAEQPIK;; $m/Z=FPEHELNVDPQR;; $m/Z=SRFPEHELNVDPQR;; $m/Z=YFQHLLGK;; $m/Z=DAVIYPILVEFTR;; $m/Z=VEFEELCADLFDR;; $m/Z=TLGGLEMoxELR;; $m/Z=EAGTQPQLQIR;; $m/Z=TKEAGTQPQLQIR;; $m/Z=EVEEEPGLR }

  peptide masses:  {  (TRPSIN)
 $m/Z= 859.4595 (0), 864.3722 (0), 1005.5234 (0),
  1040.5146 (0), 1057.4968 (0), 1134.5621 (0), 1168.6096 (0),
  1240.6448 (0), 1347.6461 (0), 1469.7883 (0), 1480.7294 (0),
  1535.8315 (0), 1585.7618 (0), 1642.7317 (0), 1677.8433 (0),
  1683.809 (0), 1719.8457 (0), 1723.8419 (0), 1898.8694 (0),
  2095.1067 (0), 2368.135 (0), 2542.1846 (0), 2726.2568 (0),
  3006.5127 (0) }
[Click to access protein entry]
 Spot: 363 (ob21dsub)
 pI: 9.10 Mw: 50000
 %vol: 0.493132   %od: 0.261155
 ================
 *EF1A1_RAT*
  accession n°: P62630

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=KDGSASGTTLLEALDCcamILPPTRPTDKPLR;; $m/Z=RYEEIVK;; $m/Z=IGGIGTVPVGR;; $m/Z=EHALLAYTLGVK;; $m/Z=YYVTIIDAPGHR;; $m/Z=THINIVVIGHVDSGK;; $m/Z=DGSASGTTLLEALDCcamILPPTRPTDKPLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 936.5104 (0), 1025.578 (0), 1314.6976 (0),
  1404.7014 (0), 1588.8342 (0), 2994.5208 (0), 3122.5981 (0)
  }
[Click to access protein entry]
 Spot: 406 (ob21dsub)
 pI: 6.90 Mw: 46000
 %vol: 0.180919   %od: 0.108856
 ================
 *ODPA_RAT*
  accession n°: P26284

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MoxVNSNLASVEELKEIDVEVR;; $m/Z=MoxVNSNLASVEELK;; $m/Z=TREEIQEVR;; $m/Z=YHGHSMoxSDPGVSYR;; $m/Z=GPILMoxELQTYR;; $m/Z=FAAAYCR;; $m/Z=GDFIPGLR;; $m/Z=RGDFIPGLR;; $m/Z=YGMoxGTSVER;; $m/Z=LPCIFICENNR;; $m/Z=LEEGPPVTTVLTR;; $m/Z=EIDVEVR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 858.4043 (0), 859.4249 (0), 874.4826 (0),
  1015.4725 (0), 1030.5973 (0), 1159.6287 (0), 1336.7129 (0),
  1411.8112 (0), 1435.7428 (0), 1449.757 (0), 1608.7245 (0),
  2290.1787 (0) }
[Click to access protein entry]
 Spot: 350 (ob21dsub)
 pI: 6.38 Mw: 50000
 %vol: 0.0652454   %od: 0.15779
 ================
 *SSDH_RAT*
  accession n°: P51650

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LGTVADCGVPEAR;; $m/Z=RVYGDIIYTSAK;; $m/Z=NAGQTCVCSNRFLVQR;; $m/Z=VGNGFEEGTTQGPLINEK;; $m/Z=RHQSGGNFFEPTLLSNVTR;; $m/Z=HQSGGNFFEPTLLSNVTR;; $m/Z=YGIDEYLEVK;; $m/Z=VGGPADLHADLLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1228.6193 (0), 1333.7391 (0), 1344.6781 (0),
  1385.7405 (0), 1889.9401 (0), 1909.9283 (0), 2004.0173 (0),
  2160.1299 (0) }
[Click to access protein entry]
 Spot: 276 (ob21dsub)
 pI: 5.84 Mw: 58000
 %vol: 0.18214   %od: 0.188415
 ================
 *DPYL3_RAT*
  accession n°: Q62952

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GNVVFGEPITASLGIDGTHYWSK;; $m/Z=MoxVMoxPGGIDVHTHFQMoxPYK;; $m/Z=SCcamCcamDYALHVDITHWNDSVK;; $m/Z=IVNDDQSFYADIYMEDGLIK;; $m/Z=IVNDDQSFYADIYMoxEDGLIK;; $m/Z=AALAGGTTMIIDHVVPEPESSLTEAYEK;; $m/Z=AALAGGTTMoxIIDHVVPEPESSLTEAYEK;; $m/Z=MLEMGITGPEGHVLSRPEELEAEAVFR;; $m/Z=MoxLEMGITGPEGHVLSRPEELEAEAVFR;; $m/Z=MoxLEMoxGITGPEGHVLSRPEELEAEAVFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 2135.9165 (0), 2319.9705 (0), 2349.051 (0),
  2365.0408 (0), 2448.1677 (0), 2929.3972 (0), 2945.4109 (0),
  2997.4187 (0), 3013.4365 (0), 3029.3945 (0)
  }
[Click to access protein entry]
 Spot: 456 (ob21dsub)
 pI: 5.56 Mw: 43000
 %vol: 0.0508409   %od: 0.113581
 ================
 *PSD13_RAT*
  accession n°: B0BN93

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VHMoxTWVQPR;; $m/Z=LYENFISEFEHR;; $m/Z=QWLIDTLYAFNSGDVDR;; $m/Z=ALSVGLVR;; $m/Z=SAWGQQPDLAANEAQLLR;; $m/Z=VNPLSLVEIILHVVR;; $m/Z=AFTLGLAGLLGEGVFNFGELLMoxHPVLESLR;; $m/Z=MoxKDVPAFLQQSQSSGPGQAAVWHR;; $m/Z=DVPAFLQQSQSSGPGQAAVWHR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 814.5201 (0), 1169.6055 (0), 1583.7626 (0),
  1701.0577 (0), 1968.0038 (0), 2012.98 (0), 2366.1711 (0),
  2641.3054 (0), 3216.6877 (0) }
[Click to access protein entry]
 Spot: 513 (ob21dsub)
 pI: 5.39 Mw: 38000
 %vol: 0.139869   %od: 0.156829
 ================
 *PP2AB_RAT*
  accession n°: P62716

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VRYPER;; $m/Z=GGWGISPR;; $m/Z=RTPDYFL;; $m/Z=GEPHVTRR;; $m/Z=QLNENQVR;; $m/Z=AHQLVMEGYNWCcamHDR;; $m/Z=YSFLQFDPAPR;; $m/Z=QITQVYGFYDECcamLRK;; $m/Z=NVVTIFSAPNYCcamYR,255268;; $m/Z=AHQLVMoxEGYNWCcamHDR;; $m/Z=QITQVYGFYDECcamLR;; $m/Z=SPDTNYLFMGDYVDR;; $m/Z=SPDTNYLFMoxGDYVDR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 819.4323 (0), 829.4205 (0), 911.4471 (0), 951.4946 (0),
  1000.5015 (0), 1340.6252 (0), 1703.7693 (0), 1791.7716 (0),
  1792.7521 (0), 1808.7032 (0), 1915.7567 (0), 1919.8466 (0),
  1931.746 (0) }
[Click to access protein entry]
 Spot: 395 (ob21dsub)
 pI: 5.91 Mw: 48000
 %vol: 0.0689216   %od: 0.21602
 ================
 *NDUS2_RAT*
  accession n°: Q641Y2

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=IIEQCLNK;; $m/Z=LYTEGYQVPPGATYTAIEAPK;; $m/Z=APGFAHLAGLDK;; $m/Z=KTQPYDVYDQVEFDVPIGSR;; $m/Z=GSGIQWDLR;; $m/Z=TVDIGVVSAEDALNYGFSGVMoxLR;; $m/Z=IDEVEEMoxLTNNR;; $m/Z=IDEVEEMLTNNR;; $m/Z=MFEFYER;; $m/Z=VLFGEITR;; $m/Z=LLNIQPPPR;; $m/Z=TYLQALPYFDR;; $m/Z=LVLELSGEMoxVR;; $m/Z=LVLELSGEMVR;; $m/Z=VVTNVTLNFGPQHPAAHGVLR;; $m/Z=ETAHWKPPPWNDVDVLK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 934.5729 (0), 1017.5723 (0), 1021.493 (0),
  1031.572 (0), 1047.6719 (0), 1196.6782 (0), 1245.7194 (0),
  1261.7213 (0), 1386.7667 (0), 1462.7448 (0), 1478.7269 (0),
  2032.0791 (0), 2227.2881 (0), 2269.1616 (0), 2356.2158 (0),
  2429.2593 (0) }
[Click to access protein entry]
 Spot: 271 (ob21dsub)
 pI: 6.75 Mw: 58000
 %vol: 0.076902   %od: 0.0864363
 ================
 *DPYL1_RAT*
  accession n°: Q62950

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NLHQSNFSLSGAQIDDNNPR;; $m/Z=IINDDQSFYADVYLEDGLIK;; $m/Z=GPLVFGEPIAASLGTDGTHYWSK;; $m/Z=ILEMGITGPEGHALSRPEELEAEAVFR;; $m/Z=ILEMoxGITGPEGHALSRPEELEAEAVFR;; $m/Z=DLYQMoxSDSQLYEAFTFLK;; $m/Z=GLGAVILVHAENGDLIAQEQK;; $m/Z=IAVGSDADVVIWDPDKMoxK;; $m/Z=IAVGSDADVVIWDPDKMK;; $m/Z=DNFTLIPEGVNGIEER;; $m/Z=AIAIAGRINCcamPVYITK;; $m/Z=GVNSFQVYMoxAYK;; $m/Z=MTVVWDKAVATGK;; $m/Z=KPFPEHLYQR;; $m/Z=VFGLHSVSR;; $m/Z=SAADIIALAR;; $m/Z=IFNLYPR;; $m/Z=HQPPPIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 844.4854 (0), 922.5212 (0), 1000.5909 (0),
  1001.5665 (0), 1314.7024 (0), 1405.7723 (0), 1422.6744 (0),
  1759.9481 (0), 1802.8947 (0), 1958.9924 (0), 1974.9681 (0),
  2175.158 (0), 2214.9929 (0), 2227.0405 (0), 2331.1697 (0),
  2403.1746 (0), 2951.439 (0), 2967.4502 (0)
  }
[Click to access protein entry]
 Spot: 98 (ob21dsub)
 pI: 6.28 Mw: 95000
 %vol: 0.123396   %od: 0.189017
 ================
 *ODO1_RAT*
  accession n°: Q5XI78

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VYYDLTR;; $m/Z=NQGYYDYVKPR;; $m/Z=AKPVWYAGR;; $m/Z=YHLGMoxYHR;; $m/Z=YHLGMYHRR;; $m/Z=DVVVDLVCYR;; $m/Z=ICEEAFTR;; $m/Z=LSGQDVER;; $m/Z=RQILLPFR;; $m/Z=QILLPFR;; $m/Z=TSFDEMoxLPGTHFQR;; $m/Z=LNVLANVIR;; $m/Z=FEEFLQR;; $m/Z=VFHLPTTTFIGGQEPALPLR;; $m/Z=NTNAGAPPGTAYQSPLSLSR;; $m/Z=SWDIFFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 886.5171 (0), 903.4254 (0), 929.4437 (0), 968.4539 (0),
  970.4523 (0), 1011.5935 (0), 1025.4521 (0), 1042.6005 (0),
  1047.5385 (0), 1092.4827 (0), 1232.5651 (0), 1237.5786 (0),
  1402.6315 (0), 1681.6981 (0), 2001.9286 (0), 2194.1304 (0)
  }
[Click to access protein entry]
 Spot: 715 (ob21dsub)
 pI: 5.93 Mw: 20000
 %vol: 0.073365   %od: 0.0552806
 ================
 *FRIL1_RAT*
  accession n°: P02793

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MoxGNHLTNLR;; $m/Z=TDPHLCDFLESHFLDK;; $m/Z=NLNQALLDLHALGSAR;; $m/Z=TLEAMoxEAALALEK;; $m/Z=ALFQDVQKPSQDEWGK;; $m/Z=DDVALEGVGHFFR;; $m/Z=ASYTYLSLGFFFDR;; $m/Z=LVNLHLR;; $m/Z=QNYSTEVEAAVNR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 864.5347 (0), 1071.5334 (0), 1405.7059 (0),
  1461.7257 (0), 1480.7078 (0), 1686.8386 (0), 1705.9384 (0),
  1875.917 (0), 1973.9015 (0) }
[Click to access protein entry]
 Spot: 311 (ob21dsub)
 pI: 6.33 Mw: 54000
 %vol: 0.0788521   %od: 0.147421
 ================
 *SERA_RAT*
  accession n°: O08651

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TLGILGLGR;; $m/Z=ILQDGGLQVVEK;; $m/Z=EELIAELQDCEGLIVR;; $m/Z=VTADVINAAEK;; $m/Z=AGTGVDNVDLEAATR;; $m/Z=QIPQATASMoxK;; $m/Z=ALQSGQCAGAALDVFTEEPPR;; $m/Z=ALVDHENVISCPHLGASTK;; $m/Z=GTIQVVTQGTSLK;; $m/Z=NAGTCLSPAVIVGLLR;; $m/Z=RGQPLLLFR;; $m/Z=GQPLLLFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 899.5873 (0), 943.5952 (0), 1090.5953 (0),
  1099.6432 (0), 1130.6157 (0), 1298.7509 (0), 1331.7711 (0),
  1488.771 (0), 1640.9539 (0), 1886.9962 (0), 2048.0664 (0),
  2217.1089 (0) }
[Click to access protein entry]
 Spot: 433 (ob21dsub)
 pI: 6.08 Mw: 45000
 %vol: 0.0833725   %od: 0.128203
 ================
 *SEPT2_RAT*
  accession n°: Q91Y81

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YLHDESGLNRR;; $m/Z=YLHDESGLNR;; $m/Z=LTVVDTPGYGDAINSR;; $m/Z=TVQIEASTVEIEER;; $m/Z=QQPTQFINPETPGYVGFANLPNQVHR;; $m/Z=ILDEIEEHSIK;; $m/Z=ASIPFSVVGSNQLIEAK;; $m/Z=RILDEIEEHSIK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1203.6029 (0), 1325.6991 (0), 1359.6901 (0),
  1481.7896 (0), 1603.8304 (0), 1677.8546 (0), 1759.9469 (0),
  2952.4451 (0) }
[Click to access protein entry]
 Spot: 701 (ob21dsub)
 pI: 5.34 Mw: 21000
 %vol: 0.243319   %od: 0.246857
 ================
 *PRDX2_RAT*
  accession n°: P35704

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NDEGIAYR;; $m/Z=GLFIIDAK;; $m/Z=SLSQNYGVLKNDEGIAYR;; $m/Z=LGCcamEVLGVSVDSQFTHLAWINTPR;; $m/Z=LGCcamEVLGVSVDSQFTHLAWINTPRK;; $m/Z=KEGGLGPLNIPLLADVTK;; $m/Z=EGGLGPLNIPLLADVTK;; $m/Z=QITVNDLPVGR;; $m/Z=SLSQNYGVLK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 876.4949 (0), 937.4202 (0), 1108.5809 (0),
  1211.6569 (0), 1706.9531 (0), 1835.0511 (0), 2027.0023 (0),
  2699.3452 (0), 2827.4253 (0) }
[Click to access protein entry]
 Spot: 94 (ob21dsub)
 pI: 6.35 Mw: 95000
 %vol: 0.0368867   %od: 0.169363
 ================
 *HXK1_RAT*
  accession n°: P05708

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MoxCINTEWGAFGDDGSLEDIR;; $m/Z=AILQQLGLNSTCDDSILVK;; $m/Z=GLDHLNVTVGVDGTLYK;; $m/Z=LHPHFSR;; $m/Z=FLSQIESDR;; $m/Z=MISGMYLGEIVR;; $m/Z=GDFIALDLGGSSFR;; $m/Z=ATDCEGHDVASLLR;; $m/Z=FNTSDVSAIEK;; $m/Z=ITPELLTR;; $m/Z=EGLLFEGR;; $m/Z=MoxVSGMoxYMoxGELVR;; $m/Z=SANLVAATLGAILNR;; $m/Z=HIDLVEGDEGR;; $m/Z=IDEAVLITWTK;; $m/Z=LPVGFTFSFPCR;; $m/Z=KLPVGFTFSFPCR;; $m/Z=GAALITAVGVR;; $m/Z=MoxLPTFVR;; $m/Z=LSDEILIDILTR;; $m/Z=YLYAMoxR;; $m/Z=SIPDGTEHGDFLALDLGGTNFR;; $m/Z=MoxLPSFVR;; $m/Z=QIEETLAHFR;; $m/Z=GAAMoxVTAVAYR;; $m/Z=LVPDSDVRFLLSESGTGK;; $m/Z=LVPDSDVR;; $m/Z=MoxHPQYSR;; $m/Z=TTVGVDGSLYK;; $m/Z=LALLQVR;; $m/Z=LGVEPSDVDCVSVQHICTIVSFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 812.5329 (0), 832.4024 (0), 865.4669 (0), 879.4808 (0),
  893.4874 (0), 900.488 (0), 920.4962 (0), 934.4301 (0),
  942.5717 (0), 1027.6418 (0), 1094.5658 (0), 1125.5825 (0),
  1139.5935 (0), 1210.6066 (0), 1239.6179 (0), 1243.6639 (0),
  1288.7024 (0), 1384.7079 (0), 1400.7458 (0), 1420.6405 (0),
  1427.7443 (0), 1454.7512 (0), 1483.8807 (0), 1543.744 (0),
  1555.8365 (0), 1800.9528 (0), 1919.9575 (0), 2088.0986 (0),
  2302.0076 (0), 2332.1421 (0), 2617.2947 (0)
  }
[Click to access protein entry]
 Spot: 203 (ob21dsub)
 pI: 5.87 Mw: 75000
 %vol: 0.0511218   %od: 0.100439
 ================
 *GPDM_RAT*
  accession n°: P35571

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LVSEFPYIEAEVK;; $m/Z=LAFLNVQAAEEALPK;; $m/Z=ELNWSELR;; $m/Z=TEQLTDSTEISLLPPDIDR;; $m/Z=GFITIVDVQR;; $m/Z=NYLSCDVEVR;; $m/Z=LHNLNAGPSR;; $m/Z=DWSPTLYIR;; $m/Z=LVQDYGLESEVAQHLAK;; $m/Z=AFDVAKMASVTGK;; $m/Z=RWPVVGVR;; $m/Z=WPVVGVR;; $m/Z=CVINATGPFTDSVRK;; $m/Z=CVINATGPFTDSVR;; $m/Z=DVLTGHEFNVR;; $m/Z=MNLAIALTAAR;; $m/Z=LVGAIVYYDGQHNDAR;; $m/Z=AITNLDVEQYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 812.4796 (0), 968.5867 (0), 1046.5348 (0),
  1078.5475 (0), 1144.624 (0), 1147.6608 (0), 1150.5988 (0),
  1254.5996 (0), 1286.6505 (0), 1321.6781 (0), 1324.6389 (0),
  1523.7888 (0), 1536.7473 (0), 1613.8754 (0), 1664.8398 (0),
  1790.8774 (0), 1899.974 (0), 2143.0603 (0)
  }
[Click to access protein entry]
 Spot: 200 (ob21dsub)
 pI: 6.31 Mw: 76000
 %vol: 0.0213127   %od: 0.0740023
 ================
 *MOES_RAT*
  accession n°: O35763

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=QLFDQVVK;; $m/Z=IGFPWSEIR;; $m/Z=APDFVFYAPR;; $m/Z=ESPLLFKFR;; $m/Z=IQVWHEEHR;; $m/Z=KAPDFVFYAPR;; $m/Z=APDFVFYAPRLR;; $m/Z=GMoxLREDAVLEYLK;; $m/Z=EVWFFGLQYQDTK;; $m/Z=VTTMoxDAELEFAIQPNTTGK;; $m/Z=GSELWLGVDALGLNIYEQNDR;; $m/Z=LFFLQVK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 894.5623 (0), 976.559 (0), 1104.6071 (0),
  1136.6012 (0), 1182.6174 (0), 1233.6328 (0), 1310.7148 (0),
  1451.826 (0), 1552.8317 (0), 1660.8268 (0), 2082.0254 (0),
  2362.1958 (0) }
[Click to access protein entry]
 Spot: 489 (ob21dsub)
 pI: 5.71 Mw: 41000
 %vol: 0.0773294   %od: 0.169823
 ================
 *IDH3A_RAT*
  accession n°: Q99NA5

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=RIAEFAFEYAR;; $m/Z=APIQWEER;; $m/Z=TPIAAGHPSMoxNLLLR;; $m/Z=KTFDLYANVRPCVSIEGYK;; $m/Z=TFDLYANVRPCVSIEGYK;; $m/Z=TPYTDVNIVTIR;; $m/Z=ENTEGEYSGIEHVIVDGVVQSIK;; $m/Z=IAEFAFEYAR;; $m/Z=MSDGLFLQK;; $m/Z=DMoxANPTALLLSAVMoxMoxLR;; $m/Z=HMGLFDHAAK;; $m/Z=HMoxGLFDHAAK;; $m/Z=CSDFTEEICR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1028.5306 (0), 1054.5211 (0), 1126.5742 (0),
  1142.5491 (0), 1216.6116 (0), 1316.5583 (0), 1372.7046 (0),
  1391.7511 (0), 1606.8575 (0), 1894.9137 (0), 2132.0344 (0),
  2260.1255 (0), 2502.1963 (0) }
[Click to access protein entry]
 Spot: 612 (ob21dsub)
 pI: 7.03 Mw: 28000
 %vol: 0.141467   %od: 0.133076
 ================
 *PSA4_RAT*
  accession n°: P21670

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HYGFQLYQSDPSGNYGGWK;; $m/Z=VEIATLTR;; $m/Z=QAYTQFGGK;; $m/Z=TTIFSPEGR;; $m/Z=LLDEVFFSEK;; $m/Z=RPFGVSLLYIGWDK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 902.5404 (0), 999.496 (0), 1007.5284 (0),
  1226.6309 (0), 1650.9008 (0), 2203.9751 (0)
  }
[Click to access protein entry]
 Spot: 527 (ob21dsub)
 pI: 5.77 Mw: 37000
 %vol: 0.117431   %od: 0.141257
 ================
 *MDHC_RAT*
  accession n°: O88989

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NVIIWGNHSSTQYPDVNHAK;; $m/Z=ELTEEKETAFEFLSSA;; $m/Z=VIVVGNPANTNCcamLTASK;; $m/Z=EVGVYEALKDDSWLK;; $m/Z=FVEGLPINDFSR;; $m/Z=DLDVAVLVGSMoxPR;; $m/Z=GEFITTVQQR;; $m/Z=ENFSCcamLTR;; $m/Z=EKMDLTAK;; $m/Z=LGVTADDVK;; $m/Z=AISDHIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 811.4769 (0), 917.519 (0), 935.5046 (0), 1026.5176 (0),
  1178.671 (0), 1387.7922 (0), 1393.7756 (0), 1751.9594 (0),
  1757.9923 (0), 1830.9333 (0), 2280.2129 (0)
  }
[Click to access protein entry]
 Spot: 115 (ob21dsub)
 pI: 5.44 Mw: 95000
 %vol: 0.157853   %od: 0.147149
 ================
 *TERA_RAT*
  accession n°: P46462

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AHVIVMoxAATNRPNSIDPALR;; $m/Z=FDREVDIGIPDATGR;; $m/Z=EVDIGIPDATGRLEILQIHTK;; $m/Z=LADDVDLEQVANETHGHVGADLAALCSEAALQAIR;; $m/Z=WALSQSNPSALR;; $m/Z=ETVVEVPQVTWEDIGGLEDVKR;; $m/Z=ELQELVQYPVEHPDKFLK;; $m/Z=GVLFYGPPGCGK;; $m/Z=AIANECQANFISIK;; $m/Z=GPELLTMoxWFGESEANVR;; $m/Z=EIFDKAR;; $m/Z=NVFIIGATNRPDIIDPAILRPGR;; $m/Z=LDQLIYIPLPDEK;; $m/Z=LDQLIYIPLPDEKSR;; $m/Z=ESIESEIRR;; $m/Z=KYEMoxFAQTLQQSR;; $m/Z=RIVSQLLTLMoxDGLK;; $m/Z=NAPAIIFIDELDAIAPKR;; $m/Z=LAGESESNLR;; $m/Z=AVANETGAFFFLINGPEIMoxSK;; $m/Z=GILLYGPPGTGK;; $m/Z=AIGVKPPR;; $m/Z=EMoxVELPLRHPALFK;; $m/Z=QLAQIKEMoxVELPLR;; $m/Z=GDIFLVR;; $m/Z=KGDIFLVR;; $m/Z=EAVCIVLSDDTCSDEKIR;; $m/Z=MoxDELQLFRGDTVLLK;; $m/Z=MoxDELQLFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 819.498 (0), 837.5626 (0), 878.5101 (0), 947.6112 (0),
  1067.5618 (0), 1075.5897 (0), 1118.6246 (0), 1172.7008 (0),
  1251.6638 (0), 1329.7426 (0), 1556.8831 (0), 1578.8591 (0),
  1602.9674 (0), 1645.8549 (0), 1660.9082 (0), 1683.9866 (0),
  1695.9713 (0), 1793.9973 (0), 1800.0416 (0), 1951.9861 (0),
  1967.1533 (0), 2110.0515 (0), 2162.21 (0), 2212.2209 (0),
  2272.2073 (0), 2318.3306 (0), 2498.345 (0), 2518.4895 (0),
  3672.8486 (0) }
[Click to access protein entry]
 Spot: 342 (ob21dsub)
 pI: 6.85 Mw: 50000
 %vol: 0.0900559   %od: 0.14272
 ================
 *DHE3_RAT*
  accession n°: P10860

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ELEDFKLQHGSILGFPK;; $m/Z=KGFIGPGIDVPAPDMSTGER;; $m/Z=IIKPCcamNHVLSLSFPIRR;; $m/Z=IIAEGANGPTTPEADKIFLER;; $m/Z=YERDSNYHLLMSVQESLER;; $m/Z=NIMVIPDLYLNAGGVTVSYFEWLK;; $m/Z=NIMoxVIPDLYLNAGGVTVSYFEWLK;; $m/Z=GVFHGIENFINEASYMSILGMTPGLGDK;; $m/Z=GVFHGIENFINEASYMoxSILGMTPGLGDK;; $m/Z=GVFHGIENFINEASYMoxSILGMoxTPGLGDK;; $m/Z=DSNYHLLMoxSVQESLER;; $m/Z=DSNYHLLMSVQESLER;; $m/Z=GFIGPGIDVPAPDMSTGER;; $m/Z=IIKPCcamNHVLSLSFPIR;; $m/Z=TFVVQGFGNVGLHSMoxR;; $m/Z=TFVVQGFGNVGLHSMR;; $m/Z=HGGTIPVVPTAEFQDR;; $m/Z=DIVHSGLAYTMER;; $m/Z=DDGSWEVIEGYR;; $m/Z=NLNHVSYGR;; $m/Z=MVEGFFDR;; $m/Z=YNLGLDLR;; $m/Z=LTFKYER }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 956.5094 (0), 963.5213 (0), 1000.457 (0),
  1059.5265 (0), 1425.6211 (0), 1491.7172 (0), 1723.8745 (0),
  1748.8821 (0), 1764.8723 (0), 1894.0634 (0), 1915.9149 (0),
  1920.9032 (0), 1936.9366 (0), 1958.0255 (0), 2044.0068 (0),
  2050.1519 (0), 2242.1604 (0), 2369.2053 (0), 2742.3999 (0),
  2758.4683 (0), 2997.4207 (0), 3013.4033 (0), 3029.3958 (0)
  }
[Click to access protein entry]
 Spot: 607 (ob21dsub)
 pI: 6.23 Mw: 29000
 %vol: 0.0316352   %od: 0.0522841
 ================
 *GSTO1_RAT*
  accession n°: Q9Z339

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LWMoxATMoxQEDPVASSHFIDAK;; $m/Z=LEALELNECIDHTPK;; $m/Z=LEEAMANK;; $m/Z=VPSLVTSFIR;; $m/Z=MoxTFELFSK;; $m/Z=LFPDDPYEK;; $m/Z=NKPEWFFEK;; $m/Z=HEIININLK;; $m/Z=FCPFAQR;; $m/Z=GSAPPGPVPEGQIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 905.4417 (0), 925.4293 (0), 1018.4716 (0),
  1093.5874 (0), 1118.6483 (0), 1123.5162 (0), 1224.5757 (0),
  1361.7043 (0), 1781.8163 (0), 2308.9766 (0)
  }
[Click to access protein entry]
 Spot: 261 (ob21dsub)
 pI: 5.86 Mw: 60000
 %vol: 0.0381607   %od: 0.155301
 ================
 *TCPA_RAT*
  accession n°: P28480

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=WIGLDLVHGKPR;; $m/Z=FATEAAITILR;; $m/Z=SVVPGGGAVEAALSIYLENYATSMoxGSR;; $m/Z=TSASIILR;; $m/Z=YFVEAGAMAVR;; $m/Z=EQLAIAEFAR;; $m/Z=SLLVIPNTLAVNAAQDSTDLVAK;; $m/Z=AFHNEAQVNPER;; $m/Z=AFHNEAQVNPERK;; $m/Z=QAGVFEPTIVK;; $m/Z=LGVQVVITDPEKLDQIR;; $m/Z=IACLDFSLQK;; $m/Z=YPVNSVNILK;; $m/Z=YINENLIINTDELGR;; $m/Z=IHPTSVISGYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 860.5307 (0), 1146.6537 (0), 1147.6292 (0),
  1188.6661 (0), 1194.6249 (0), 1205.704 (0), 1213.6265 (0),
  1229.6555 (0), 1390.8083 (0), 1411.6864 (0), 1539.7804 (0),
  1776.9243 (0), 1923.1005 (0), 2353.2974 (0), 2715.3369 (0)
  }
[Click to access protein entry]
 Spot: 319 (ob21dsub)
 pI: 6.64 Mw: 51000
 %vol: 0.120377   %od: 0.154582
 ================
 *DHE3_RAT*
  accession n°: P10860

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NIMoxVIPDLYLNAGGVTVSYFEWLK;; $m/Z=YNLGLDLR;; $m/Z=MVEGFFDR;; $m/Z=MoxVEGFFDR;; $m/Z=NLNHVSYGR;; $m/Z=DDGSWEVIEGYR;; $m/Z=DIVHSGLAYTMER;; $m/Z=HGGTIPVVPTAEFQDR;; $m/Z=TFVVQGFGNVGLHSMR;; $m/Z=TFVVQGFGNVGLHSMoxR;; $m/Z=IIKPCcamNHVLSLSFPIR;; $m/Z=DSNYHLLMSVQESLER;; $m/Z=GFIGPGIDVPAPDMoxSTGER;; $m/Z=DSNYHLLMoxSVQESLER;; $m/Z=KGFIGPGIDVPAPDMoxSTGER;; $m/Z=IIAEGANGPTTPEADKIFLER;; $m/Z=GVFHGIENFINEASYMoxSILGMoxTPGLGDK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 963.5257 (0), 1000.4492 (0), 1016.4368 (0),
  1059.5338 (0), 1425.6155 (0), 1491.712 (0), 1723.8595 (0),
  1748.8701 (0), 1764.8551 (0), 1894.0448 (0), 1920.8894 (0),
  1931.8887 (0), 1936.8734 (0), 2060.0127 (0), 2242.1213 (0),
  2758.3774 (0), 3029.3674 (0) }
[Click to access protein entry]
 Spot: 408 (ob21dsub)
 pI: 6.90 Mw: 46000
 %vol: 0.17896   %od: 0.211478
 ================
 *LIS1_RAT*
  accession n°: P63004

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TLNAHEHFVTSLDFHK;; $m/Z=SNGYEEAYSVFK;; $m/Z=EEFTSGGPLGQK;; $m/Z=EWIPRPPEK;; $m/Z=VIFHPVFSVMoxVSASEDATIK;; $m/Z=GHTDSVQDISFDHSGK;; $m/Z=LWDFQGFECIR;; $m/Z=TMoxHGHDHNVSSVAIMoxPNGDHIVSASR;; $m/Z=MoxWEVQTGYCVK;; $m/Z=MVRPNQDGTLIASCSNDQTVR;; $m/Z=MoxVRPNQDGTLIASCSNDQTVR;; $m/Z=EHEHVVECISWAPESSYSSISEATGSETK;; $m/Z=SGKPGPFLLSGSR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1151.6354 (0), 1249.6559 (0), 1302.7056 (0),
  1393.6512 (0), 1416.6206 (0), 1470.6967 (0), 1729.7814 (0),
  1895.9388 (0), 2193.114 (0), 2362.1545 (0), 2378.105 (0),
  2801.2593 (0), 3236.3999 (0) }
[Click to access protein entry]
 Spot: 512 (ob21dsub)
 pI: 5.42 Mw: 39000
 %vol: 0.0664193   %od: 0.182446
 ================
 *PP2AA_RAT*
  accession n°: P63331

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=RTPDYFL;; $m/Z=GGWGISPR;; $m/Z=GEPHVTRR;; $m/Z=YSFLQFDPAPR;; $m/Z=NVVTIFSAPNYCcamYR,255268;; $m/Z=QITQVYGFYDECcamLR;; $m/Z=SPDTNYLFMGDYVDR;; $m/Z=SPDTNYLFMoxGDYVDR;; $m/Z=AHQLVMEGYNWCcamHDR;; $m/Z=QITQVYGFYDECcamLRK;; $m/Z=AHQLVMoxEGYNWCcamHDR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 829.4205 (0), 911.4471 (0), 951.4946 (0),
  1340.6252 (0), 1703.7693 (0), 1791.7716 (0), 1792.7521 (0),
  1808.7032 (0), 1915.7567 (0), 1919.8466 (0), 1931.746 (0)
  }
[Click to access protein entry]
 Spot: 625 (ob21dsub)
 pI: 5.57 Mw: 27000
 %vol: 0.0686002   %od: 0.109995
 ================
 *NDUS3_MOUSE*
  accession n°: Q9DCT2

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FDLNSPWEAFPAYR;; $m/Z=RLSAFGEYVAEILPK;; $m/Z=LSAFGEYVAEILPK;; $m/Z=FEIVYNLLSLR;; $m/Z=TYADELTAIDSIVSVHIAANWYER;; $m/Z=EVWDMFGVFFFNHPDLR;; $m/Z=EVWDMoxFGVFFFNHPDLR;; $m/Z=ILTDYGFEGHPFR;; $m/Z=ILTDYGFEGHPFRK;; $m/Z=KDFPLTGYVELR;; $m/Z=DFPLTGYVELR;; $m/Z=YDDEVKR;; $m/Z=VVAEPVELAQEFR;; $m/Z=KFDLNSPWEAFPAYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 924.4692 (0), 1309.7183 (0), 1366.8142 (0),
  1437.8131 (0), 1486.8306 (0), 1536.8568 (0), 1551.7996 (0),
  1679.8973 (0), 1692.9703 (0), 1712.8496 (0), 1840.9441 (0),
  2156.0432 (0), 2172.0313 (0), 2737.3694 (0)
  }
[Click to access protein entry]
 Spot: 547 (ob21dsub)
 pI: 6.40 Mw: 32000
 %vol: 0.151079   %od: 0.107553
 ================
 *VDAC2_RAT*
  accession n°: P81155

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VNNSSLIGVGYTQTLRPGVK;; $m/Z=DIFNKGFGFGLVK;; $m/Z=LTFDTTFSPNTGKK;; $m/Z=SNFAVGYR;; $m/Z=TGDFQLHTNVNNGTEFGGSIYQK;; $m/Z=VCEDFDTSVNLAWTSGTNCTR;; $m/Z=YQLDPTASISAK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 913.418 (0), 1293.6315 (0), 1441.7501 (0),
  1556.7725 (0), 2103.1348 (0), 2433.0264 (0), 2527.177 (0)
  }
[Click to access protein entry]
 Spot: 675 (ob21dsub)
 pI: 6.43 Mw: 23000
 %vol: 0.13358   %od: 0.0891143
 ================
 *GSTA3_RAT*
  accession n°: P04904

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GRMoxESIR;; $m/Z=YFPVFEK;; $m/Z=FLQPGSQR;; $m/Z=LYYFQGR;; $m/Z=KPPPDGHYVDVVR;; $m/Z=APQEKEESLALAVK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 864.3996 (0), 929.4383 (0), 932.4603 (0), 946.4467 (0),
  1478.7345 (0), 1512.7646 (0) }
[Click to access protein entry]
 Spot: 243 (ob21dsub)
 pI: 5.62 Mw: 63000
 %vol: 0.0607744   %od: 0.167428
 ================
 *ODP2_RAT*
  accession n°: P08461

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LQPHEFQGGTFTISNLGMoxFGIK;; $m/Z=VPLPSLSPTMoxQAGTIAR;; $m/Z=ILVPEGTR;; $m/Z=DVPLGTPLCIIVEK;; $m/Z=VFVSPLAK;; $m/Z=DIDSFVPTK;; $m/Z=AAPAAAAAAPPGPR;; $m/Z=VAPTPAGVFIDIPISNIR;; $m/Z=QTIPHYYLSVDVNMoxGEVLLVR;; $m/Z=ISVNDFIIK;; $m/Z=VPEANSSWMoxDTVIR;; $m/Z=GFDVASVMoxSVTLSCDHR;; $m/Z=VVDGAVGAQWLAEFK;; $m/Z=YLEKPVTMoxLL }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 860.5173 (0), 884.5245 (0), 1021.5318 (0),
  1048.6034 (0), 1188.6619 (0), 1222.6666 (0), 1553.8512 (0),
  1589.8319 (0), 1620.7792 (0), 1754.9534 (0), 1880.0769 (0),
  1896.8744 (0), 2438.2192 (0), 2462.2681 (0)
  }
[Click to access protein entry]
 Spot: 253 (ob21dsub)
 pI: 5.89 Mw: 61000
 %vol: 0.121315   %od: 0.198643
 ================
 *DPYL2_RAT*
  accession n°: P47942

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DRFQLTDSQIYEVLSVIR;; $m/Z=QIGENLIVPGGVK;; $m/Z=MoxVIPGGIDVHTR;; $m/Z=GIQEEMoxEALVK;; $m/Z=DHGVNSFLVYMoxAFK,158-171;; $m/Z=FQLTDSQIYEVLSVIR;; $m/Z=DIGAIAQVHAENGDIIAEEQQR;; $m/Z=ILDLGITGPEGHVLSRPEEVEAEAVNR;; $m/Z=SITIANQTNCPLYVTK;; $m/Z=SAAEVIAQAR;; $m/Z=DNFTLIPEGTNGTEER;; $m/Z=VFNLYPR;; $m/Z=ISVGSDADLVIWDPDSVK;; $m/Z=THNSALEYNIFEGMoxECR;; $m/Z=IVLEDGTLHVTEGSGR;; $m/Z=NLHQSGFSLSGAQIDDNIPR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 908.5162 (0), 1015.5775 (0), 1262.6583 (0),
  1310.7056 (0), 1323.7329 (0), 1643.8192 (0), 1682.8997 (0),
  1792.9037 (0), 1822.9529 (0), 1911.0574 (0), 1916.002 (0),
  2086.9336 (0), 2169.1111 (0), 2182.1829 (0), 2377.2141 (0),
  2900.5479 (0) }
[Click to access protein entry]
 Spot: 461 (ob21dsub)
 pI: 5.89 Mw: 42000
 %vol: 0.0347105   %od: 0.117451
 ================
 *NDUAA_RAT*
  accession n°: Q561S0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VVEDIEYLNYNK;; $m/Z=MoxSEICEVLVYSSWEAEDSTK;; $m/Z=VTSAYLQDIEDAYKK;; $m/Z=HYPEAGIQYSSSTTGDGRPLDIEFSGSCSLEK;; $m/Z=LQSWLYASR;; $m/Z=LLQYSDALEHLLSTGQGVVLER;; $m/Z=SIYSDFVFLEAMoxYNQGFIR;; $m/Z=LTLPEYLPPHAVIYIDVPVSEIQSR;; $m/Z=KQCVDHYNEIK;; $m/Z=QCVDHYNEIKR;; $m/Z=EVLNYTTVPVYLPEITIGAHQGSR;; $m/Z=VTSAYLQDIEDAYK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1123.6066 (0), 1433.6991 (0), 1461.7061 (0),
  1498.7471 (0), 1615.7893 (0), 1743.8794 (0), 2316.0955 (0),
  2379.0334 (0), 2441.3008 (0), 2657.3892 (0), 2849.5325 (0),
  3488.5442 (0) }
[Click to access protein entry]
 Spot: 587 (ob21dsub)
 pI: 5.59 Mw: 31000
 %vol: 0.057649   %od: 0.111753
 ================
 *PHB_RAT*
  accession n°: P67779

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DLQNVNITLR;; $m/Z=ILFRPVASQLPR;; $m/Z=IYTSIGEDYDER;; $m/Z=FDAGELITQR;; $m/Z=AATFGLILDDVSLTHLTFGK;; $m/Z=AAELIANSLATAGDGLIELR;; $m/Z=KLEAAEDIAYQLSR;; $m/Z=FGLALAVAGGVVNSALYNVDAGHR,12-35 }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1149.5947 (0), 1185.6625 (0), 1396.8406 (0),
  1460.6836 (0), 1606.8409 (0), 1998.068 (0), 2119.1184 (0),
  2371.2378 (0) }
[Click to access protein entry]
 Spot: 385 (ob21dsub)
 pI: 6.31 Mw: 50000
 %vol: 0.0977755   %od: 0.199304
 ================
 *EF1G_RAT*
  accession n°: Q68FR6

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=EYFSWEGAFQHVGK;; $m/Z=TFLVGER;; $m/Z=QVLEPSFR;; $m/Z=STFVLDEFK;; $m/Z=ILGLLDTHLK;; $m/Z=STFVLDEFKR;; $m/Z=ALIAAQYSGAQIR;; $m/Z=DGWSLWYAEYR;; $m/Z=KLDPGSEETQTLVR;; $m/Z=WFLTCcamINQPQFR;; $m/Z=NAFASVILFGTNNSSSISGVWVFR;; $m/Z=GQDLAFPLSPDWQVDYESYTWR;; $m/Z=KNAFASVILFGTNNSSSISGVWVFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 821.4348 (0), 975.5189 (0), 1085.524 (0),
  1122.6727 (0), 1241.6456 (0), 1361.7504 (0), 1445.6473 (0),
  1572.8309 (0), 1609.7927 (0), 1684.7737 (0), 2573.3113 (0),
  2673.2285 (0), 2701.4072 (0) }
[Click to access protein entry]
 Spot: 129 (ob21dsub)
 pI: 6.27 Mw: 95000
 %vol: 0.0364795   %od: 0.150972
 ================
 *DYN1_RAT*
  accession n°: P21575

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VLNQQLTNHIR;; $m/Z=EVDEYKNFRPDDPAR;; $m/Z=NFRPDDPAR;; $m/Z=ALLQMoxVQQFAVDFEK;; $m/Z=RIEGSGDQIDTYELSGGAR;; $m/Z=IEGSGDQIDTYELSGGAR;; $m/Z=FPFELVK;; $m/Z=CVDMVVSELTSTIR;; $m/Z=CVDMoxVVSELTSTIR;; $m/Z=TSGNQDEILVIR;; $m/Z=HIFALFNTEQR;; $m/Z=NVYKDYR;; $m/Z=DYRQLELACETQEEVDSWK;; $m/Z=KFTDFEEVR;; $m/Z=FTDFEEVR;; $m/Z=GMoxEDLIPLVNR;; $m/Z=SSVLENFVGR;; $m/Z=RPLVLQLVNSTTEYAEFLHCK;; $m/Z=GISPVPINLR;; $m/Z=VPVGDQPPDIEFQIR;; $m/Z=EVDPQGQR;; $m/Z=LDLMoxDEGTDAR;; $m/Z=GYIGVVNR;; $m/Z=DITAALAAER;; $m/Z=KFFLSHPSYR;; $m/Z=FFLSHPSYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 877.4615 (0), 879.4579 (0), 928.4259 (0), 957.4554 (0),
  1030.5336 (0), 1042.4733 (0), 1065.6178 (0), 1087.5033 (0),
  1107.5549 (0), 1153.5602 (0), 1170.5472 (0), 1251.5231 (0),
  1272.6128 (0), 1281.651 (0), 1335.7213 (0), 1344.683 (0),
  1375.683 (0), 1609.7693 (0), 1625.7319 (0), 1709.8365 (0),
  1782.8302 (0), 1850.8126 (0), 1867.834 (0), 2023.9052 (0),
  2398.9683 (0), 2518.2402 (0) }
[Click to access protein entry]
 Spot: 320 (ob21dsub)
 pI: 7.05 Mw: 52000
 %vol: 0.174438   %od: 0.133123
 ================
 *CAP1_RAT*
  accession n°: Q08163

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SSEMNVLIPTEGGDFNEFPVPEQFK;; $m/Z=SSEMoxNVLIPTEGGDFNEFPVPEQFK;; $m/Z=HVDWVR;; $m/Z=EMoxNDAAMoxFYTNR;; $m/Z=AYLSIWTELQAYIK;; $m/Z=EMNDAAMFYTNR;; $m/Z=LSDLLAPISEQIQEVITFR;; $m/Z=ALLVTASQCQQPAGNK;; $m/Z=GAVPYVQAFDSLLANPVAEYLK;; $m/Z=EMoxNDAAMFYTNR;; $m/Z=ELSGLPSGPSVGSGPPPPPPGPPPPPVPTSSGSDDSASR;; $m/Z=SALFAQINQGESITHALK;; $m/Z=WRVENQENVSNLVIDDTELK;; $m/Z=VENQENVSNLVIDDTELK;; $m/Z=QVAYIYK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 811.4385 (0), 884.4869 (0), 1462.6503 (0),
  1478.6276 (0), 1494.627 (0), 1685.881 (0), 1698.9296 (0),
  1928.0433 (0), 2059.0576 (0), 2172.2209 (0), 2365.2568 (0),
  2401.2007 (0), 2811.3274 (0), 2827.3137 (0), 3614.7522 (0)
  }
[Click to access protein entry]
 Spot: 345 (ob21dsub)
 pI: 5.94 Mw: 51000
 %vol: 0.0434935   %od: 0.130233
 ================
 *ALDH2_RAT*
  accession n°: P11884

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TIPIDGDFFSYTR;; $m/Z=VAEQTPLTALYVANLIK;; $m/Z=VAFTGSTEVGHLIQVAAGSSNLK;; $m/Z=TFVQEDVYDEFVER;; $m/Z=SRVVGNPFDSR;; $m/Z=VVGNPFDSR;; $m/Z=TEQGPQVDETQFK;; $m/Z=GYFIQPTVFGDVK;; $m/Z=EEIFGPVMoxQILK;; $m/Z=TIEEVVGR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 902.512 (0), 990.5267 (0), 1233.6819 (0),
  1419.7706 (0), 1470.78 (0), 1506.738 (0), 1531.7745 (0),
  1775.8436 (0), 1844.0566 (0), 2286.2205 (0)
  }
[Click to access protein entry]
 Spot: 534 (ob21dsub)
 pI: 5.40 Mw: 34000
 %vol: 0.135143   %od: 0.19593
 ================
 *ACTG_RAT*
  accession n°: P63259

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=IIAPPERK;; $m/Z=DLYANTVLSGGTTMoxYPGIADR;; $m/Z=KDLYANTVLSGGTTMoxYPGIADR;; $m/Z=SYELPDGQVITIGNER;; $m/Z=GYSFTTTAER;; $m/Z=TTGIVMoxDSGDGVTHTVPIYEGYALPHAILR;; $m/Z=VAPEEHPVLLTEAPLNPKANR;; $m/Z=VAPEEHPVLLTEAPLNPK;; $m/Z=IWHHTFYNELR;; $m/Z=RGILTLK;; $m/Z=AVFPSIVGRPR;; $m/Z=AGFAGDDAPR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 800.5502 (0), 923.5888 (0), 976.4796 (0),
  1132.5676 (0), 1198.7461 (0), 1515.8018 (0), 1790.9492 (0),
  1954.1108 (0), 2231.116 (0), 2295.3367 (0), 2359.209 (0),
  3199.6643 (0) }
[Click to access protein entry]
 Spot: 159 (ob21dsub)
 pI: 6.97 Mw: 83000
 %vol: 0.125515   %od: 0.198077
 ================
 *K6PP_RAT*
  accession n°: P47860

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AMEWISAK;; $m/Z=NVLGHMoxQQGGAPSPFDR;; $m/Z=LPLMECVQMTQDVQK;; $m/Z=GGTPSAFDR;; $m/Z=VTILGHVQR;; $m/Z=ELVVTNLGFDTRVTILGHVQR;; $m/Z=ELVVTNLGFDTR;; $m/Z=IKELVVTNLGFDTR;; $m/Z=LNIIIVSEGAIDTQNKPITSEK;; $m/Z=TFVLEVMoxGR;; $m/Z=IIEVVDAIMoxTTAQSHQR;; $m/Z=LGITNLCVIGGDGSLTGANLFR;; $m/Z=WECVSSILQVGGTIIGSAR;; $m/Z=DLLFKPVAELR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 907.4376 (0), 935.502 (0), 1022.6235 (0),
  1067.5547 (0), 1300.7799 (0), 1363.74 (0), 1604.8567 (0),
  1819.9388 (0), 1826.8776 (0), 1927.9974 (0), 2033.0703 (0),
  2248.1853 (0), 2367.2759 (0), 2383.3018 (0)
  }
[Click to access protein entry]
 Spot: 621 (ob21dsub)
 pI: 5.96 Mw: 28000
 %vol: 0.0509705   %od: 0.0834753
 ================
 *GSTM5_RAT*
  accession n°: Q9Z1B2

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=CLDEFPNLK;; $m/Z=SMVLGYWDIR;; $m/Z=IAAFLQSDR;; $m/Z=SMoxVLGYWDIR;; $m/Z=MLLEFTDTSYEEK;; $m/Z=MoxLLEFTDTSYEEK;; $m/Z=LDLDFPNLPYLMoxDGK;; $m/Z=ITQSNAILR;; $m/Z=IRVDIMoxENQIMoxDFR;; $m/Z=VDIMoxENQIMDFR;; $m/Z=VDIMoxENQIMoxDFR;; $m/Z=LCYNSNHESLKPQYLEQLPAQLK;; $m/Z=QFSLFLGK;; $m/Z=FTWFAGEK;; $m/Z=LTFVDFLTYDVLDQNR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 939.5471 (0), 985.5071 (0), 1015.6208 (0),
  1020.5803 (0), 1135.5731 (0), 1239.6599 (0), 1255.6475 (0),
  1526.7367 (0), 1542.723 (0), 1605.7673 (0), 1621.7581 (0),
  1766.8962 (0), 1811.9072 (0), 1959.0284 (0), 2773.4282 (0)
  }
[Click to access protein entry]
 Spot: 327 (ob21dsub)
 pI: 6.35 Mw: 52000
 %vol: 0.0719907   %od: 0.166178
 ================
 *FSCN1_RAT*
  accession n°: P85845

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GEHGFIGCR;; $m/Z=YAHLSARPADEIAVDR;; $m/Z=DVPWGVDSLITLAFQDQR;; $m/Z=YSVQTSDHR;; $m/Z=LVARPEPATGFTLEFR;; $m/Z=YLAPSGPSGTLK;; $m/Z=VGKDELFALEQSCAQVVLQAANER;; $m/Z=QGMDLSANQDEETDQETFQLEIDR;; $m/Z=YWTLTATGGVQSTASTK;; $m/Z=NASCYFDIEWCER;; $m/Z=LINRPIIVFR;; $m/Z=WSVHIAMoxHPQVNIYSVTR;; $m/Z=SSYDVFQLEFNDGAYNIK;; $m/Z=YLKGDHAGVLK;; $m/Z=YLTAEAFGFK;; $m/Z=KQIWTLEQPPDEAGSAAVCLR;; $m/Z=QIWTLEQPPDEAGSAAVCLR;; $m/Z=YLAADKDGNVTCER;; $m/Z=EVPDGDCR;; $m/Z=FLVVAHDDGR;; $m/Z=WSLQSEAHR;; $m/Z=WSLQSEAHRR;; $m/Z=YFGGTEDR;; $m/Z=LSCFAQSVSPAEK;; $m/Z=WSVHIAMHPQVNIYSVTR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 944.4459 (0), 947.4302 (0), 1032.5037 (0),
  1092.5504 (0), 1113.583 (0), 1128.6165 (0), 1146.6136 (0),
  1190.6658 (0), 1200.6978 (0), 1240.8267 (0), 1269.6796 (0),
  1423.7153 (0), 1611.7944 (0), 1749.7493 (0), 1771.9182 (0),
  1783.9426 (0), 1804.0138 (0), 2060.0881 (0), 2110.0061 (0),
  2138.136 (0), 2154.124 (0), 2241.1357 (0), 2369.2329 (0),
  2675.3823 (0), 2812.2461 (0) }
[Click to access protein entry]
 Spot: 241 (ob21dsub)
 pI: 6.37 Mw: 63000
 %vol: 0.0909358   %od: 0.144672
 ================
 *STIP1_RAT*
  accession n°: O35814

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GDYPQAMK;; $m/Z=DCEECIQLEPTFIK;; $m/Z=IGNSYFKEER;; $m/Z=AMoxADPEVQQIMoxSDPAMoxR;; $m/Z=YKDAIHFYNK;; $m/Z=EQVNELKEK;; $m/Z=ALSAGNIDDALQCYSEAIK;; $m/Z=LDPQNHVLYSNR;; $m/Z=KAAALEFLNR;; $m/Z=AAALEFLNR;; $m/Z=AAALEFLNRFEEAK;; $m/Z=TYEEGLKHEANNLQLK;; $m/Z=EGLQNMoxEAR;; $m/Z=TLLSDPTYR;; $m/Z=ELIEQLQNKPSDLGTK;; $m/Z=ELDPTNMoxTYITNQAAVHFEK;; $m/Z=ENREDYR;; $m/Z=AYARIGNSYFK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 909.4214 (0), 981.4201 (0), 1004.5339 (0),
  1063.4581 (0), 1065.5267 (0), 1116.5986 (0), 1132.6227 (0),
  1242.5842 (0), 1289.6616 (0), 1298.6057 (0), 1455.6906 (0),
  1608.7781 (0), 1781.7434 (0), 1812.8813 (0), 1886.8905 (0),
  1937.7493 (0), 2038.8828 (0), 2337.989 (0)
  }
[Click to access protein entry]
 Spot: 240 (ob21dsub)
 pI: 6.62 Mw: 63000
 %vol: 0.12454   %od: 0.135058
 ================
 *STXB1_RAT*
  accession n°: P61765

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=WEVLIGSTHILTPQK;; $m/Z=YGHWHK;; $m/Z=VLVVDQLSMoxR;; $m/Z=MoxTDIMoxTEGITIVEDINKR;; $m/Z=REPLPSLEAVYLITPSEK;; $m/Z=SVHSLISDFKDPPTAK;; $m/Z=YRGEYK;; $m/Z=SQLLILDR;; $m/Z=YETSGIGEAR;; $m/Z=HKHIAEVSQEVTR;; $m/Z=HIAEVSQEVTR;; $m/Z=ISEQTYQLSR;; $m/Z=LDTKHYPYISTR;; $m/Z=HYPYISTR;; $m/Z=SSASFSTTAVSAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 815.4106 (0), 827.4125 (0), 957.5803 (0),
  1036.5338 (0), 1082.5271 (0), 1175.6427 (0), 1224.6316 (0),
  1268.671 (0), 1271.6548 (0), 1493.7466 (0), 1533.8168 (0),
  1721.9513 (0), 1741.8931 (0), 2042.1213 (0), 2111.03 (0)
  }
[Click to access protein entry]
 Spot: 401 (ob21dsub)
 pI: 5.03 Mw: 47000
 %vol: 0.574059   %od: 0.235874
 ================
 *ENOG_RAT*
  accession n°: P07323

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=CITGDQLGALYQDFVR;; $m/Z=AAVPSGASTGIYEALELR;; $m/Z=AAVPSGASTGIYEALELRDGDK;; $m/Z=AVDHINSTIAPALISSGLSVVEQEK;; $m/Z=HIAQLAGNSDLILPVPAFNVINGGSHAGNK;; $m/Z=LAMoxQEFMILPVGAESFR;; $m/Z=LAMoxQEFMoxILPVGAESFR;; $m/Z=LGAEVYHTLK;; $m/Z=DATNVGDEGGFAPNILENSEALELVK;; $m/Z=MVIGMDVAASEFYR;; $m/Z=MoxVIGMDVAASEFYR;; $m/Z=MoxVIGMoxDVAASEFYR;; $m/Z=FTANVGIQIVGDDLTVTNPK;; $m/Z=SGETEDTFIADLVVGLCTGQIK;; $m/Z=YNQLMoxR;; $m/Z=IEEELGEEAR;; $m/Z=FAGHNFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 840.4045 (0), 848.4196 (0), 1130.6179 (0),
  1174.5775 (0), 1588.7717 (0), 1604.7611 (0), 1620.7512 (0),
  1804.967 (0), 1855.9094 (0), 1955.0031 (0), 1970.9893 (0),
  2102.1211 (0), 2220.1328 (0), 2353.1714 (0), 2578.3804 (0),
  2702.3206 (0), 3024.6111 (0) }
[Click to access protein entry]
 Spot: 299 (ob21dsub)
 pI: 5.61 Mw: 56000
 %vol: 0.0500637   %od: 0.120512
 ================
 *PDIA3_RAT*
  accession n°: P11598

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TFSHELSDFGLESTTGEIPVVAIR;; $m/Z=FVMoxQEEFSR;; $m/Z=FLQEYFDGNLKR;; $m/Z=SEPIPETNEGPVK;; $m/Z=VVVAESFDDIVNAEDK;; $m/Z=YKELGEK;; $m/Z=GFPTIYFSPANK;; $m/Z=GFPTIYFSPANKK;; $m/Z=ELNDFISYLQR;; $m/Z=EATNPPIIQEEKPK;; $m/Z=DGEEAGAYDGPR;; $m/Z=QAGPASVPLR;; $m/Z=DLFSDGHSEFLK;; $m/Z=FAHTNVESLVK;; $m/Z=EYDDNGEGITIFRPLHLANK;; $m/Z=IVAYTEK;; $m/Z=DLLTAYYDVDYEK;; $m/Z=TFLDAGHK;; $m/Z=LNFAVASR;; $m/Z=KTFSHELSDFGLESTTGEIPVVAIR;; $m/Z=LAPEYEAAATR;; $m/Z=YGVSGYPTLK;; $m/Z=IFRDGEEAGAYDGPR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 823.4756 (0), 866.4867 (0), 877.522 (0), 888.4894 (0),
  995.6074 (0), 1084.6122 (0), 1188.5848 (0), 1191.6533 (0),
  1236.5709 (0), 1244.7111 (0), 1341.7319 (0), 1394.7185 (0),
  1396.7365 (0), 1397.762 (0), 1469.8512 (0), 1529.8417 (0),
  1593.9023 (0), 1607.8014 (0), 1652.8132 (0), 1749.9091 (0),
  2302.2183 (0), 2605.3865 (0), 2733.4963 (0)
  }
[Click to access protein entry]
 Spot: 268 (ob21dsub)
 pI: 6.39 Mw: 58000
 %vol: 0.100305   %od: 0.150016
 ================
 *DPYL1_RAT*
  accession n°: Q62950

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=KGPLVFGEPIAASLGTDGTHYWSK;; $m/Z=STVEYNIFEGMECcamHGSPLVVISQGK;; $m/Z=STVEYNIFEGMoxECcamHGSPLVVISQGK;; $m/Z=AALAGGTTMIIDHVVPEPGSSLLTSFEK;; $m/Z=ILEMGITGPEGHALSRPEELEAEAVFR;; $m/Z=ILEMoxGITGPEGHALSRPEELEAEAVFR;; $m/Z=MoxVIPGGIDVNTYLQKPSQGMTSADDFFQGTR;; $m/Z=MoxVIPGGIDVNTYLQKPSQGMoxTSADDFFQGTR;; $m/Z=GPLVFGEPIAASLGTDGTHYWSK;; $m/Z=SAADIIALAR;; $m/Z=VFGLHSVSR;; $m/Z=KPFPEHLYQR;; $m/Z=MTVVWDKAVATGK;; $m/Z=DNFTLIPEGVNGIEER;; $m/Z=QIGENLIVPGGVKTIEANGR;; $m/Z=GLGAVILVHAENGDLIAQEQK;; $m/Z=DLYQMSDSQLYEAFTFLK;; $m/Z=DLYQMoxSDSQLYEAFTFLK;; $m/Z=NLHQSNFSLSGAQIDDNNPR;; $m/Z=IINDDQSFYADVYLEDGLIK;; $m/Z=IFNLYPR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 922.5267 (0), 1000.5927 (0), 1001.5743 (0),
  1314.7102 (0), 1405.7859 (0), 1802.8959 (0), 2065.0491 (0),
  2175.168 (0), 2199.0337 (0), 2215.0315 (0), 2227.0464 (0),
  2331.167 (0), 2403.189 (0), 2531.2751 (0), 2781.3157 (0),
  2797.3044 (0), 2841.4683 (0), 2951.4788 (0), 2967.4897 (0),
  3389.6189 (0), 3405.6006 (0) }
[Click to access protein entry]
 Spot: 359 (ob21dsub)
 pI: 6.71 Mw: 50000
 %vol: 0.129555   %od: 0.166048
 ================
 *6PGD_RAT*
  accession n°: P85968

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HEMoxLPANLIQAQR;; $m/Z=NPELQNLLLDDFFK;; $m/Z=QAATEFGWTLNYGGIALMoxWR;; $m/Z=IISYAQGFMoxLLR;; $m/Z=IISYAQGFMLLR;; $m/Z=QAFLEDVRK;; $m/Z=QAFLEDVR;; $m/Z=FQDTDGKELLPK;; $m/Z=TIFQAIAAK;; $m/Z=YGPSLMoxPGGNK;; $m/Z=GILFVGSGVSGGEEGAR;; $m/Z=LVPLLDTGDIIIDGGNSEYRDTTR;; $m/Z=LVPLLDTGDIIIDGGNSEYR;; $m/Z=RVILLVK;; $m/Z=AGQAVDDFIEK;; $m/Z=IKDAFER }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 840.6065 (0), 878.4852 (0), 962.56 (0), 977.5204 (0),
  1105.6077 (0), 1136.564 (0), 1192.595 (0), 1390.7163 (0),
  1411.8013 (0), 1427.777 (0), 1536.7976 (0), 1591.8146 (0),
  1705.8799 (0), 2160.1165 (0), 2301.1047 (0), 2633.3291 (0)
  }
[Click to access protein entry]
 Spot: 685 (ob21dsub)
 pI: 5.66 Mw: 22000
 %vol: 0.0667313   %od: 0.0923348
 ================
 *KCY_RAT*
  accession n°: Q4KM73

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=KNPDSQYGELIEK;; $m/Z=MoxKPLVVFVLGGPGAGK;; $m/Z=IVPVEITISLLK;; $m/Z=NKFLIDGFPR;; $m/Z=FLIDGFPR;; $m/Z=NQDNLQGWNK;; $m/Z=ADVSFVLFFDCNNEICIDR;; $m/Z=RIQTYLESTKPIIDLYEEMoxGK;; $m/Z=IQTYLESTKPIIDLYEEMoxGK;; $m/Z=SVDEVFGDVMoxK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 964.5542 (0), 1206.6915 (0), 1216.6036 (0),
  1241.599 (0), 1324.8571 (0), 1520.7804 (0), 1585.9252 (0),
  2334.0881 (0), 2387.2168 (0), 2543.3264 (0)
  }
[Click to access protein entry]
 Spot: 413 (ob21dsub)
 pI: 5.79 Mw: 46000
 %vol: 0.525828   %od: 0.271183
 ================
 *KCRB_RAT*
  accession n°: P07335

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TDLNPDNLQGGDDLDPNYVLSSR;; $m/Z=NYEFMWNPHLGYILTCcamPSNLGTGLR;; $m/Z=NYEFMoxWNPHLGYILTCcamPSNLGTGLR;; $m/Z=LRFPAEDEFPDLSSHNNHMoxAK;; $m/Z=FPAEDEFPDLSSHNNHMoxAK;; $m/Z=GTGGVDTAAVGGVFDVSNADR;; $m/Z=LGFSEVELVQMoxVVDGVK;; $m/Z=LGFSEVELVQMVVDGVK;; $m/Z=TFLVWINEEDHLR;; $m/Z=LAVEALSSLDGDLSGR;; $m/Z=FCcamTGLTQIETLFK;; $m/Z=VLTPELYAELR;; $m/Z=DLFDPIIEDR;; $m/Z=GFCcamLPPHCcamSR;; $m/Z=LLIEMoxEQR;; $m/Z=LLIEMEQR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1031.5687 (0), 1047.5476 (0), 1230.6062 (0),
  1232.6462 (0), 1303.7346 (0), 1557.8503 (0), 1602.8953 (0),
  1671.8629 (0), 1849.0177 (0), 1865.0016 (0), 1965.0107 (0),
  2202.0271 (0), 2471.2188 (0), 2518.2339 (0), 2953.4724 (0),
  2969.4634 (0) }
[Click to access protein entry]
 Spot: 125 (ob21dsub)
 pI: 6.13 Mw: 95000
 %vol: 0.03336   %od: 0.117403
 ================
 *PDC6I_RAT*
  accession n°: Q9QZA2

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=KFGEEIAR;; $m/Z=MoxVPVSVQQSLAVFSQR;; $m/Z=STAVVEQGGIQTVDQLIK;; $m/Z=ELPELLQR;; $m/Z=NREILEESLR;; $m/Z=LLDEEEATDNDLR;; $m/Z=TPSNDLYKPLR;; $m/Z=FLTALAQDGVINEEALSVTELDR;; $m/Z=NIQVSHQEFSK;; $m/Z=QSNSEASLREEVLK;; $m/Z=FYNELTEILVR;; $m/Z=CSDIVFAR;; $m/Z=EPSAPSIPPPAYQSSPAGGHATAPTPAPR;; $m/Z=DLQQSIAR;; $m/Z=KDNDFIYHDR;; $m/Z=DNDFIYHDR;; $m/Z=FIQQTYPSGGEEQAQYCR;; $m/Z=SALGRPLDKHEGALETLLR;; $m/Z=DAFDKGSLFGGSVK;; $m/Z=QYQFASGAFLHIK;; $m/Z=LANQAADYFGDAFK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 930.4638 (0), 949.4736 (0), 967.4289 (0), 997.5399 (0),
  1194.4941 (0), 1258.6447 (0), 1303.6697 (0), 1316.6301 (0),
  1322.5874 (0), 1396.7195 (0), 1427.6833 (0), 1509.7488 (0),
  1530.7003 (0), 1532.6857 (0), 1589.7919 (0), 1791.9143 (0),
  1885.9855 (0), 2076.1265 (0), 2161.9404 (0), 2504.2634 (0),
  2809.3564 (0) }
[Click to access protein entry]
 Spot: 754 (ob21dsub)
 pI: 5.12 Mw: 18000
 %vol: 0.278142   %od: 0.217896
 ================
 *OMP_RAT*
  accession n°: P08523

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=QQLDMoxPLVLDQDLTK;; $m/Z=LQFDHWNVVLDKPGK;; $m/Z=VMoxYFLITFGEGVEPANLK;; $m/Z=KVMoxYFLITFGEGVEPANLK;; $m/Z=EDSDAMDWNEADALEFGER;; $m/Z=VTITGTSQNWTPDLTNLMTR;; $m/Z=VTITGTSQNWTPDLTNLMoxTR;; $m/Z=KEDSDAMDWNEADALEFGER;; $m/Z=KEDSDAMoxDWNEADALEFGER }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1772.994 (0), 1796.0348 (0), 2044.1376 (0),
  2172.2424 (0), 2199.9758 (0), 2249.2314 (0), 2265.2212 (0),
  2328.0791 (0), 2344.0701 (0) }
[Click to access protein entry]
 Spot: 678 (ob21dsub)
 pI: 5.93 Mw: 23000
 %vol: 0.112727   %od: 0.163913
 ================
 *PARK7_RAT*
  accession n°: O88767

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TQGPYDVVVLPGGNLGAQNLSESALVK;; $m/Z=GAEEMoxETVIPVDIMR;; $m/Z=GAEEMoxETVIPVDIMoxR;; $m/Z=VTVAGLAGKDPVQCSR;; $m/Z=DPVQCSR;; $m/Z=DVVICPDTSLEEAK;; $m/Z=EILKEQENR;; $m/Z=KGLIAAICAGPTALLAHEVGFGCK;; $m/Z=GLIAAICAGPTALLAHEVGFGCK;; $m/Z=VTSHPLAK;; $m/Z=DKMMNGSHYSYSESR;; $m/Z=DKMoxMoxNGSHYSYSESR;; $m/Z=MoxMoxNGSHYSYSESR;; $m/Z=DGLILTSR;; $m/Z=GPGTSFEFALAIVEALSGK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 852.4624 (0), 861.3785 (0), 874.4877 (0),
  1158.5962 (0), 1575.7063 (0), 1580.5767 (0), 1657.8583 (0),
  1705.7686 (0), 1721.7451 (0), 1791.7346 (0), 1823.686 (0),
  1893.9294 (0), 2326.144 (0), 2454.2285 (0), 2726.3374 (0)
  }
[Click to access protein entry]
 Spot: 541 (ob21dsub)
 pI: 5.97 Mw: 31000
 %vol: 0.0706188   %od: 0.148748
 ================
 *PIPNA_RAT*
  accession n°: P16446

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AWNAYPYCR;; $m/Z=VLLKEYR;; $m/Z=VILPVSVDEYQVGQLYSVAEASK;; $m/Z=NETGGGEGVEVLVNEPYEK;; $m/Z=IYHLQSK;; $m/Z=MoxLAPEGALNIHEK;; $m/Z=TVITNEYMoxKEDFLIK;; $m/Z=IETWHKPDLGTQENVHK;; $m/Z=LEPEAWK;; $m/Z=HVEAIYIDIADR;; $m/Z=HVEAIYIDIADRSQVLSK;; $m/Z=TGRGPLGPNWK;; $m/Z=GPLGPNWK;; $m/Z=DCPYMoxCAYK;; $m/Z=FKWWGLQNK;; $m/Z=RLFTNFHR;; $m/Z=LFTNFHR;; $m/Z=QLFCWLDK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 868.4391 (0), 872.4175 (0), 888.4512 (0), 920.5353 (0),
  934.4687 (0), 1090.5609 (0), 1109.5013 (0), 1182.5869 (0),
  1200.4999 (0), 1206.597 (0), 1223.4871 (0), 1414.6937 (0),
  1438.6772 (0), 1859.8644 (0), 2019.8677 (0), 2031.9447 (0),
  2057.0291 (0), 2494.188 (0) }
[Click to access protein entry]
 Spot: 576 (ob21dsub)
 pI: 6.37 Mw: 32000
 %vol: 0.0910493   %od: 0.0654496
 ================
 *PNPH_RAT*
  accession n°: P85973

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LTQPQAFDYNEIPNFPQSTVQGHAGR;; $m/Z=LVFGFLNGR;; $m/Z=FHMYEGYSLSK;; $m/Z=FHMoxYEGYSLSK;; $m/Z=VFHLLGVDTLVVTNAAGGLNPK;; $m/Z=FEVGDIMLIR;; $m/Z=FEVGDIMoxLIR;; $m/Z=DHINLPGFCGQNPLR;; $m/Z=FPAMoxSDAYDR;; $m/Z=FPAMoxSDAYDRDMoxR;; $m/Z=ELQEGTYIMoxSAGPTFETVAESCLLR;; $m/Z=MoxLGADAVGMoxSTVPEVIVAR;; $m/Z=VFGFSLITNK;; $m/Z=LEQFVSILMoxESIPPR;; $m/Z=VVMDYNNLEK;; $m/Z=HRPQVAVICGSGLGGLTAK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1022.5475 (0), 1125.5884 (0), 1188.4679 (0),
  1192.6068 (0), 1208.6 (0), 1224.5999 (0), 1361.653 (0),
  1377.5803 (0), 1606.6434 (0), 1737.821 (0), 1774.91 (0),
  1921.0161 (0), 1947.9551 (0), 2235.2217 (0), 2818.3093 (0),
  2915.3833 (0) }
[Click to access protein entry]
 Spot: 360 (ob21dsub)
 pI: 6.92 Mw: 49000
 %vol: 0.0954806   %od: 0.182009
 ================
 *GABT_RAT*
  accession n°: P50554

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GNYLVDVDGNR;; $m/Z=MoxAFLLTTR;; $m/Z=VDFEFDYDGPLMoxK;; $m/Z=QLNTIQNAEAVHFFCNYEESR;; $m/Z=LVQQPQNASTFINRPALGILPPENFVDK;; $m/Z=TIFMWYR;; $m/Z=TIFMoxWYR;; $m/Z=IDIPSFDWPIAPFPR;; $m/Z=LKYPLEEFVTDNQQEEAR;; $m/Z=YPLEEFVTDNQQEEAR;; $m/Z=TVAGIIVEPIQSEGGDNHASDDFFR;; $m/Z=EEFRPSAPYR;; $m/Z=IFNTWLGDPSK;; $m/Z=REDLLNNVAHAGK;; $m/Z=TLLTGLLDLQAQYPQFVSR;; $m/Z=FRPTLVFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 968.545 (0), 1016.5352 (0), 1032.527 (0),
  1035.6387 (0), 1221.6333 (0), 1251.6487 (0), 1277.6843 (0),
  1436.7377 (0), 1591.756 (0), 1770.9652 (0), 1967.9443 (0),
  2163.207 (0), 2209.1079 (0), 2570.2073 (0), 2674.2927 (0),
  3106.6743 (0) }
[Click to access protein entry]
 Spot: 539 (ob21dsub)
 pI: 5.09 Mw: 31000
 %vol: 0.332278   %od: 0.131866
 ================
 *OTUB1_RAT*
  accession n°: B2RYG6

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FFEHFIEGGR;; $m/Z=LLTSGYLQR;; $m/Z=AFGFSHLEALLDDSKELQR;; $m/Z=AFGFSHLEALLDDSK;; $m/Z=TRPDGNCFYR;; $m/Z=KTRPDGNCFYR;; $m/Z=EYAEDDNIYQQK;; $m/Z=IQQEIAVQNPLVSER;; $m/Z=EFCQQEVEPMoxCK;; $m/Z=GEGGTTNPHVFPEGSEPK;; $m/Z=VYLLYRPGHYDILYK;; $m/Z=QEPLGSDSEGVNCLAYDEAIMoxAQQDR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1050.6293 (0), 1238.6356 (0), 1285.6057 (0),
  1413.704 (0), 1515.686 (0), 1600.709 (0), 1649.8472 (0),
  1723.97 (0), 1839.9028 (0), 1913.0675 (0), 2176.1311 (0),
  2912.2847 (0) }
[Click to access protein entry]
 Spot: 436 (ob21dsub)
 pI: 5.11 Mw: 45000
 %vol: 0.277856   %od: 0.182009
 ================
 *TBB5_RAT*
  accession n°: P69897

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ISEQFTAMoxFR;; $m/Z=LAVNMoxVPFPR;; $m/Z=FPGQLNADLR;; $m/Z=IREEYPDR;; $m/Z=YLTVAAVFR;; $m/Z=LHFFMPGFAPLTSR;; $m/Z=KLAVNMoxVPFPR;; $m/Z=FPGQLNADLRK;; $m/Z=LHFFMoxPGFAPLTSR;; $m/Z=ALTVPELTQQVFDAK;; $m/Z=NSSYFVEWIPNNVK;; $m/Z=MoxAVTFIGNSTAIQELFK;; $m/Z=LTTPTYGDLNHLVSATMoxSGVTTCcamLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1039.5897 (0), 1077.5251 (0), 1130.5892 (0),
  1159.6171 (0), 1245.583 (0), 1258.6792 (0), 1287.6852 (0),
  1620.8143 (0), 1636.8032 (0), 1659.8668 (0), 1696.8027 (0),
  1885.9352 (0), 2724.2708 (0) }
[Click to access protein entry]
 Spot: 127 (ob21dsub)
 pI: 6.34 Mw: 95000
 %vol: 0.0459132   %od: 0.181125
 ================
 *DYN1_RAT*
  accession n°: P21575

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VLNQQLTNHIR;; $m/Z=NFRPDDPAR;; $m/Z=ALLQMoxVQQFAVDFEK;; $m/Z=RIEGSGDQIDTYELSGGAR;; $m/Z=IEGSGDQIDTYELSGGAR;; $m/Z=FPFELVK;; $m/Z=CVDMVVSELTSTIR;; $m/Z=LREEMoxER;; $m/Z=TSGNQDEILVIR;; $m/Z=HIFALFNTEQR;; $m/Z=FFLSHPSYR;; $m/Z=KFFLSHPSYR;; $m/Z=DITAALAAER;; $m/Z=GYIGVVNR;; $m/Z=LDLMDEGTDAR;; $m/Z=EVDPQGQR;; $m/Z=VPVGDQPPDIEFQIR;; $m/Z=GISPVPINLR;; $m/Z=FTDFEEVR;; $m/Z=KFTDFEEVR;; $m/Z=RPLVLQLVNSTTEYAEFLHCK;; $m/Z=SSVLENFVGR;; $m/Z=GMoxEDLIPLVNR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 877.4639 (0), 879.4621 (0), 928.4291 (0), 978.4471 (0),
  1030.5354 (0), 1042.4696 (0), 1065.6206 (0), 1087.5052 (0),
  1107.5513 (0), 1153.5615 (0), 1170.5542 (0), 1235.561 (0),
  1272.6226 (0), 1281.6495 (0), 1335.7233 (0), 1344.6829 (0),
  1375.683 (0), 1609.7778 (0), 1709.8379 (0), 1782.838 (0),
  1867.8195 (0), 2023.8973 (0), 2518.2231 (0)
  }
[Click to access protein entry]
 Spot: 630 (ob21dsub)
 pI: 6.29 Mw: 27000
 %vol: 0.0552643   %od: 0.0876868
 ================
 *PSA6_RAT*
  accession n°: P60901

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YEAANWK;; $m/Z=YGYEIPVDMoxLCK;; $m/Z=CDPAGYYCGFK;; $m/Z=ILTEAEIDAHLVALAER;; $m/Z=ILTEAEIDAHLVALAERD;; $m/Z=HITIFSPEGR;; $m/Z=LYQVEYAFK;; $m/Z=AINQGGLTSVAVR;; $m/Z=LLDSSTVTHLFK;; $m/Z=ITENIGCVMoxTGMoxTADSR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 881.4146 (0), 1156.6147 (0), 1160.5961 (0),
  1285.7244 (0), 1337.5194 (0), 1360.7411 (0), 1503.6772 (0),
  1864.009 (0), 1887.8185 (0), 1979.0338 (0)
  }
[Click to access protein entry]
 Spot: 357 (ob21dsub)
 pI: 5.78 Mw: 49000
 %vol: 0.0717899   %od: 0.172961
 ================
 *DX39B_RAT*
  accession n°: Q63413

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ELAFQISKEYER;; $m/Z=NCcamPHIVVGTPGR;; $m/Z=DFLLKPELLR;; $m/Z=ILVATNLFGR;; $m/Z=EIRPVCcamR;; $m/Z=DVQEIFR;; $m/Z=YQQFKDFQR;; $m/Z=GSYVSIHSSGFRDFLLKPELLR;; $m/Z=VNIAFNYDMoxPEDSDTYLHR;; $m/Z=VNIAFNYDMPEDSDTYLHR;; $m/Z=CcamIALAQLLVEQNFPAIAIHR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 906.5061 (0), 929.5388 (0), 1103.708 (0),
  1243.7983 (0), 1259.6737 (0), 1306.7279 (0), 1512.8313 (0),
  2277.3313 (0), 2300.1167 (0), 2316.1089 (0), 2521.4421 (0)
  }
[Click to access protein entry]
 Spot: 585 (ob21dsub)
 pI: 6.23 Mw: 31000
 %vol: 0.0921785   %od: 0.129778
 ================
 *PSA1_RAT*
  accession n°: P18420

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HMoxSEFMoxQCNLDELVK;; $m/Z=ETLPAEQDLTTK;; $m/Z=DLEFTIYDDDDVSPFLDGLEERPQR;; $m/Z=NQYDNDVTVWSPQGR;; $m/Z=IHQIEYAMoxEAVK;; $m/Z=KILHVDNHIGISIAGLTADAR;; $m/Z=ILHVDNHIGISIAGLTADAR;; $m/Z=LLCNFMR;; $m/Z=LLCNFMoxR;; $m/Z=FVFDRPLPVSR;; $m/Z=TQIPTQR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 843.4786 (0), 953.4814 (0), 969.4713 (0),
  1332.7494 (0), 1345.6892 (0), 1447.7212 (0), 1778.8124 (0),
  1912.816 (0), 2086.1345 (0), 2214.2207 (0), 2984.3564 (0)
  }
[Click to access protein entry]
 Spot: 336 (ob21dsub)
 pI: 5.88 Mw: 51000
 %vol: 0.228828   %od: 0.202347
 ================
 *VATB2_RAT*
  accession n°: P62815

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HVLVILTDMSSYAEALR;; $m/Z=HVLVILTDMoxSSYAEALR;; $m/Z=RGFPGYMYTDLATIYER;; $m/Z=GFPGYMYTDLATIYER;; $m/Z=GFPGYMoxYTDLATIYER;; $m/Z=QIYPPINVLPSLSR;; $m/Z=AVVGEEALTSDDLLYLEFLQK;; $m/Z=NFITQGPYENR;; $m/Z=TVYETLDIGWQLLR;; $m/Z=RIPQSTLSEFYPR;; $m/Z=IPQSTLSEFYPR;; $m/Z=KTSCEFTGDILR;; $m/Z=AVVQVFEGTSGIDAKK;; $m/Z=AVVQVFEGTSGIDAK;; $m/Z=YAEIVHLTLPDGTK;; $m/Z=TVSGVNGPLVILDHVK;; $m/Z=NYLSQPR;; $m/Z=LALTTAEFLAYQCEK;; $m/Z=IPIFSAAGLPHNEIAAQICR;; $m/Z=IYPEEMoxIQTGISAIDGMoxNSIAR;; $m/Z=IYPEEMIQTGISAIDGMNSIAR;; $m/Z=GPVVLAEDFLDIMoxGQPINPQCR;; $m/Z=TPVSEDMoxLGR;; $m/Z=TSCEFTGDILR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 877.4903 (0), 1120.5725 (0), 1298.6614 (0),
  1338.6981 (0), 1426.7635 (0), 1437.7963 (0), 1520.8346 (0),
  1556.8752 (0), 1593.8992 (0), 1596.9705 (0), 1647.9711 (0),
  1648.9716 (0), 1706.9771 (0), 1757.9364 (0), 1896.9631 (0),
  1912.9373 (0), 1918.0616 (0), 1934.0519 (0), 2053.0549 (0),
  2178.2249 (0), 2353.2698 (0), 2409.2852 (0), 2441.2202 (0),
  2485.2771 (0) }
[Click to access protein entry]
 Spot: 783 (ob21dsub)
 pI: 6.78 Mw: 54000
 %vol: 0.0758277   %od: 0.0968295
 ================
 *SYN2_RAT*
  accession n°: Q63537

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TSISGNWK;; $m/Z=TNTGSAMoxLEQIAMoxSDR;; $m/Z=TPALSPQRPLTTQQPQSGTLK;; $m/Z=TPALSPQRPLTTQQPQSGTLKEPDSSK;; $m/Z=RPPPAQAPAPQPAPQPAPTPSVGSSFFSSLSQAVK;; $m/Z=QTAASAGLVDAPAPSAASR;; $m/Z=VLLVVDEPHTDWAK;; $m/Z=SFRPDFVLIR;; $m/Z=QHAFGMAENEDFR;; $m/Z=FPLIEQTYYPNHR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 892.4933 (0), 1249.7178 (0), 1551.7418 (0),
  1621.8398 (0), 1677.8512 (0), 1740.8789 (0), 1756.8267 (0),
  2249.2139 (0), 2892.458 (0), 3497.7776 (0)
  }
[Click to access protein entry]
 Spot: 659 (ob21dsub)
 pI: 5.97 Mw: 24000
 %vol: 0.0434109   %od: 0.0719025
 ================
 *RHOA_RAT*
  accession n°: P61589

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=QVELALWDTAGQEDYDR;; $m/Z=EVFEMATR;; $m/Z=IGAFGYMoxECSAK;; $m/Z=QEPVKPEEGR;; $m/Z=MoxKQEPVKPEEGR;; $m/Z=HFCPNVPIILVGNK;; $m/Z=EVFEMoxATR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 982.4948 (0), 998.4847 (0), 1168.6276 (0),
  1349.6405 (0), 1443.757 (0), 1607.8965 (0), 2008.9528 (0)
  }
[Click to access protein entry]
 Spot: 463 (ob21dsub)
 pI: 5.61 Mw: 42000
 %vol: 0.107742   %od: 0.158475
 ================
 *GNAI1_RAT*
  accession n°: P10824

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=EYQLNDSAAYYLNDLDR;; $m/Z=DSGVQACFNR;; $m/Z=IDFGDAAR;; $m/Z=LKIDFGDAAR;; $m/Z=AVVYSNTIQSIIAIIR;; $m/Z=LFDSICNNK;; $m/Z=MoxFDVGGQR;; $m/Z=TTGIVETHFTFK;; $m/Z=IAQPNYIPTQQDVLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 864.4367 (0), 925.4323 (0), 1105.5996 (0),
  1110.5437 (0), 1153.5496 (0), 1380.7133 (0), 1755.9303 (0),
  1761.011 (0), 2062.9182 (0) }
[Click to access protein entry]
 Spot: 289 (ob21dsub)
 pI: 6.90 Mw: 55000
 %vol: 0.153404   %od: 0.148777
 ================
 *KPYM_RAT*
  accession n°: P11980

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AATESFASDPILYRPVAVALDTK;; $m/Z=FDEILEASDGIMoxVAR;; $m/Z=GDLGIEIPAEKVFLAQK;; $m/Z=GDYPLEAVR;; $m/Z=EAEAAVFHR;; $m/Z=LLFEELAR;; $m/Z=CLAAALIVLTESGR;; $m/Z=DAVLDAWAEDVDLR;; $m/Z=NTGIICTIGPASR;; $m/Z=LNFSHGTHEYHAETIK;; $m/Z=RFDEILEASDGIMoxVAR;; $m/Z=IENHEGVR;; $m/Z=FGVEQDVDMoxVFASFIR;; $m/Z=GADYLVTEVENGGSLGSK;; $m/Z=IYVDDGLISLQVK;; $m/Z=LDIDSAPITAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 953.5125 (0), 990.5887 (0), 1019.5463 (0),
  1029.5464 (0), 1171.6686 (0), 1359.755 (0), 1462.8325 (0),
  1473.8365 (0), 1587.7981 (0), 1681.8446 (0), 1795.8926 (0),
  1827.9316 (0), 1837.9386 (0), 1875.9205 (0), 1883.9288 (0),
  2435.3049 (0) }
[Click to access protein entry]
 Spot: 497 (ob21dsub)
 pI: 7.13 Mw: 39000
 %vol: 0.485944   %od: 0.24694
 ================
 *G3P_RAT*
  accession n°: P04797

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LISWYDNEYGYSNR;; $m/Z=VIISAPSADAPMoxFVMoxGVNHEK;; $m/Z=WGDAGAEYVVESTGVFTTMoxEK;; $m/Z=VGVNGFGR;; $m/Z=LTGMoxAFR;; $m/Z=VPTPNVSVVDLTCcamR;; $m/Z=LVINGKPITIFQER;; $m/Z=RVIISAPSADAPMoxFVMoxGVNHEK;; $m/Z=VIHDNFGIVEGLMoxTTVHAITATQK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 805.4382 (0), 811.4112 (0), 1556.8209 (0),
  1627.9607 (0), 1779.814 (0), 2245.1125 (0), 2293.0435 (0),
  2401.2092 (0), 2611.3706 (0) }
[Click to access protein entry]
 Spot: 349 (ob21dsub)
 pI: 5.80 Mw: 50000
 %vol: 0.137341   %od: 0.194479
 ================
 *HNRH1_RAT*
  accession n°: Q8VHV7

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=STGEAFVQFASQEIAEK;; $m/Z=GLPWSCcamSADEVQR;; $m/Z=GAYGGGYGGYDDYNGYNDGYGFGSDR;; $m/Z=VTGEADVEFATHEDAVAAMoxSK;; $m/Z=YVELFLNSTAGASGGAYEHR;; $m/Z=EGRPSGEAFVELESEDEVK;; $m/Z=ATENDIYNFFSPLNPVR;; $m/Z=VHIEIGPDGR;; $m/Z=DLNYCcamFSGMoxSDHR;; $m/Z=HTGPNSPDTANDGFVR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1092.5974 (0), 1504.7268 (0), 1617.6594 (0),
  1684.7822 (0), 1841.9011 (0), 1996.9941 (0), 2106.9968 (0),
  2142.0388 (0), 2194.0139 (0), 2717.0684 (0)
  }
[Click to access protein entry]
 Spot: 331 (ob21dsub)
 pI: 7.93 Mw: 51000
 %vol: 0.374897   %od: 0.28436
 ================
 *ATPA_RAT*
  accession n°: P15999

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FESAFLSHVVSQHQSLLGNIR;; $m/Z=TSIAIDTIINQK;; $m/Z=HALIIYDDLSK;; $m/Z=EAYPGDVFYLHSR;; $m/Z=GIRPAINVGLSVSR;; $m/Z=EVAAFAQFGSDLDAATQQLLSR;; $m/Z=QGQYSPMoxAIEEQVAVIYAGVR;; $m/Z=ILGADTSVDLEETGR;; $m/Z=VLSIGDGIAR;; $m/Z=NVQAEEMoxVEFSSGLK;; $m/Z=GMoxSLNLEPDNVGVVVFGNDK;; $m/Z=TGAIVDVPVGDELLGR;; $m/Z=AVDSLVPIGR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1000.6063 (0), 1026.6228 (0), 1287.7174 (0),
  1316.7493 (0), 1438.8782 (0), 1553.774 (0), 1575.8215 (0),
  1610.9021 (0), 1683.8096 (0), 2120.0425 (0), 2325.1792 (0),
  2338.1948 (0), 2369.2568 (0) }
[Click to access protein entry]
 Spot: 700 (ob21dsub)
 pI: 5.47 Mw: 20000
 %vol: 0.265129   %od: 0.243236
 ================
 *PEBP1_RAT*
  accession n°: P31044

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FKVESFR;; $m/Z=EWHHFLVVNMoxK;; $m/Z=LYTLVLTDPDAPSR;; $m/Z=FREWHHFLVVNMK;; $m/Z=FREWHHFLVVNMoxK;; $m/Z=GNDISSGTVLSEYVGSGPPK;; $m/Z=VLTPTQVMoxNRPSSISWDGLDPGK;; $m/Z=YVWLVYEQEQPLNCcamDEPILSNK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 912.4695 (0), 1455.6974 (0), 1560.8052 (0),
  1742.8757 (0), 1758.8654 (0), 1963.9342 (0), 2514.2488 (0),
  2737.3103 (0) }
[Click to access protein entry]
 Spot: 782 (ob21dsub)
 pI: 5.46 Mw: 38000
 %vol: 0.00703921   %od: 0.0492641
 ================
 *CRYM_RAT*
  accession n°: Q9QYU4

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GPDGGVMoxQPVR;; $m/Z=LVYDSWSSGK;; $m/Z=SLGMoxAVEDLVAAK,291303;; $m/Z=APAFLSADEVQDHLR;; $m/Z=GPDGGVMQPVRTVVPVAK;; $m/Z=RAPAFLSADEVQDHLR;; $m/Z=QAVLYVDSR;; $m/Z=FASSVQGDVR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1050.5333 (0), 1065.5104 (0), 1128.5162 (0),
  1141.5242 (0), 1319.6416 (0), 1668.7698 (0), 1806.9703 (0),
  1824.8572 (0) }
[Click to access protein entry]
 Spot: 600 (ob21dsub)
 pI: 5.96 Mw: 29000
 %vol: 0.0248305   %od: 0.0452414
 ================
 *ERP29_RAT*
  accession n°: P52555

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SLNILTAFR;; $m/Z=WASQYLKIMGK;; $m/Z=WASQYLK;; $m/Z=GQGVYLGMoxPGCLPAYDALAGQFIEASSR;; $m/Z=DGDFENPVPYSGAVK;; $m/Z=LDKESYPVFYLFR;; $m/Z=LAENSASSDDLLVAEVGISDYGDK;; $m/Z=QDEFKR;; $m/Z=FDTQYPYGEK;; $m/Z=KEELQR;; $m/Z=ILDQGEDFPASELAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 802.4395 (0), 822.4113 (0), 895.4633 (0),
  1034.6012 (0), 1247.5521 (0), 1324.6915 (0), 1594.7216 (0),
  1660.804 (0), 1676.8477 (0), 2468.1172 (0), 2944.3259 (0)
  }
[Click to access protein entry]
 Spot: 702 (ob21dsub)
 pI: 6.32 Mw: 20000
 %vol: 0.0437801   %od: 0.04346
 ================
 *RAB2A_RAT*
  accession n°: P05712

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GAAGALLVYDITRR;; $m/Z=KEEGEAFAR;; $m/Z=TASNVEEAFINTAK;; $m/Z=YIIIGDTGVGK;; $m/Z=SCLLLQFTDKR;; $m/Z=LQIWDTAGQESFR;; $m/Z=GAAGALLVYDITR;; $m/Z=DTFNHLTTWLEDAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1036.4835 (0), 1135.6008 (0), 1319.7065 (0),
  1380.6974 (0), 1475.781 (0), 1494.7217 (0), 1550.7377 (0),
  1718.816 (0) }
[Click to access protein entry]
 Spot: 432 (ob21dsub)
 pI: 7.03 Mw: 45000
 %vol: 0.126603   %od: 0.160468
 ================
 *KCRU_RAT*
  accession n°: P25809

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LYPPSAEYPDLR;; $m/Z=LYPPSAEYPDLRK;; $m/Z=TVGMoxVAGDEETYEVFAELFDPVIQER;; $m/Z=GLSLPPACTR;; $m/Z=SFLIWVNEEDHTR;; $m/Z=GWEFMWNER;; $m/Z=GWEFMoxWNER;; $m/Z=LGYILTCPSNLGTGLR;; $m/Z=RLYPPSAEYPDLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1071.5786 (0), 1254.5558 (0), 1270.5465 (0),
  1420.7291 (0), 1548.8187 (0), 1576.8254 (0), 1645.8141 (0),
  1734.936 (0), 2960.3589 (0) }
[Click to access protein entry]
 Spot: 231 (ob21dsub)
 pI: 5.39 Mw: 67000
 %vol: 0.268456   %od: 0.269508
 ================
 *LMNB1_RAT*
  accession n°: P70615

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ALYETELADARR;; $m/Z=LALDMoxEISAYRK;; $m/Z=IQELEDMoxLAKER;; $m/Z=CcamQSLTEDLEFRK;; $m/Z=LYKEELEQTYHAK;; $m/Z=FKAEHDQLLLNYAK;; $m/Z=MRIESLSSQLSNLQK;; $m/Z=QLADETLLKVDLENR;; $m/Z=NQNSWGTGEDVKVVLK;; $m/Z=MoxRIESLSSQLSNLQK;; $m/Z=FHQQGTPR;; $m/Z=LAVYIDKVR;; $m/Z=NSQGEEVAQR;; $m/Z=ALYETELADAR;; $m/Z=LREYEAALNSK;; $m/Z=HETRLVEVDSGR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 970.5269 (0), 1076.6925 (0), 1117.5742 (0),
  1251.6742 (0), 1293.7345 (0), 1397.6965 (0), 1407.7794 (0),
  1425.797 (0), 1490.8076 (0), 1525.7947 (0), 1651.9 (0),
  1689.9617 (0), 1733.9889 (0), 1749.9833 (0), 1757.0135 (0),
  1773.9838 (0) }
[Click to access protein entry]
 Spot: 689 (ob21dsub)
 pI: 8.47 Mw: 21000
 %vol: 0.132281   %od: 0.112838
 ================
 *PRDX1_RAT*
  accession n°: Q63716

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TIAQDYGVLK;; $m/Z=RTIAQDYGVLK;; $m/Z=QGGLGPMoxNIPLVSDPKR;; $m/Z=KQGGLGPMoxNIPLVSDPK;; $m/Z=DISLSDYK;; $m/Z=ATAVMoxPDGQFK;; $m/Z=IGHPAPSFK;; $m/Z=LVQAFQFTDK;; $m/Z=SVDEILR;; $m/Z=QITINDLPVGR;; $m/Z=GLFIIDDKGILR;; $m/Z=GLFIIDDK;; $m/Z=ADEGISFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 831.4802 (0), 894.4612 (0), 920.5258 (0), 940.4877 (0),
  953.538 (0), 1107.6196 (0), 1180.6129 (0), 1196.6465 (0),
  1225.718 (0), 1263.7034 (0), 1359.8242 (0), 1766.9442 (0),
  1794.9517 (0) }
[Click to access protein entry]
 Spot: 517 (ob21dsub)
 pI: 6.75 Mw: 38000
 %vol: 0.10444   %od: 0.123467
 ================
 *PRPS1_RAT*
  accession n°: P60892

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VYAILTHGIFSGPAISR;; $m/Z=LNVDFALIHK;; $m/Z=VTAVIPCFPYAR;; $m/Z=FSNQETCVEIGESVR;; $m/Z=KFSNQETCVEIGESVR;; $m/Z=IQVIDISMoxILAEAIR;; $m/Z=MoxVLVGDVK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 876.4991 (0), 1169.6805 (0), 1393.7958 (0),
  1700.9698 (0), 1754.885 (0), 1802.0695 (0), 1882.9698 (0)
  }
[Click to access protein entry]
 Spot: 415 (ob21dsub)
 pI: 6.32 Mw: 46000
 %vol: 0.158615   %od: 0.198042
 ================
 *ACTZ_RAT*
  accession n°: P85515

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DWNDMoxERIWQYVYSK;; $m/Z=LYSTWIGGSILASLDTFKK;; $m/Z=ACcamYLSINPQKDETLETEK;; $m/Z=EYEEDGAR;; $m/Z=APELLFRPDLIGEESEGIHEVLVFAIQK;; $m/Z=DWNDMER;; $m/Z=ISAPQER;; $m/Z=DQLQTFSEEHPVLLTEAPLNPR;; $m/Z=DWNDMoxER;; $m/Z=IWQYVYSK;; $m/Z=YCcamFPNYVGRPK;; $m/Z=VMAGALEGDIFIGPK;; $m/Z=VMoxAGALEGDIFIGPK;; $m/Z=TLFSNIVLSGGSTLFK;; $m/Z=EGYDFHSSSEFEIVK;; $m/Z=AQYYLPDGSTIEIGPSR;; $m/Z=KEGYDFHSSSEFEIVK;; $m/Z=LYSTWIGGSILASLDTFK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 800.4211 (0), 965.4047 (0), 968.4162 (0), 981.3854 (0),
  1086.5698 (0), 1400.6814 (0), 1517.7938 (0), 1533.7815 (0),
  1683.9172 (0), 1773.7898 (0), 1866.9156 (0), 1901.901 (0),
  1972.0189 (0), 2048.9468 (0), 2100.1194 (0), 2139.0168 (0),
  2534.2727 (0), 3149.676 (0) }
[Click to access protein entry]
 Spot: 208 (ob21dsub)
 pI: 5.97 Mw: 73000
 %vol: 0.109389   %od: 0.221093
 ================
 *GRP75_RAT*
  accession n°: P48721

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MPKVQQTVQDLFGR;; $m/Z=VQQTVQDLFGRAPSK;; $m/Z=ETGVDLTKDNMALQR;; $m/Z=NAVITVPAYFNDSQR;; $m/Z=ETGVDLTKDNMoxALQR;; $m/Z=QAVTNPNNTFYATKR;; $m/Z=STNGDTFLGGEDFDQALLR;; $m/Z=LLGQFTLIGIPPAPR;; $m/Z=AQFEGIVTDLIKR;; $m/Z=SDIGEVILVGGMoxTR;; $m/Z=TTPSVVAFTPDGER;; $m/Z=EMAGDNKLLGQFTLIGIPPAPR;; $m/Z=EMoxAGDNKLLGQFTLIGIPPAPR;; $m/Z=SQVFSTAADGQTQVEIKVCQGER;; $m/Z=QATKDAGQISGLNVLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1462.8298 (0), 1476.8043 (0), 1489.9059 (0),
  1593.0269 (0), 1646.9478 (0), 1670.9987 (0), 1673.976 (0),
  1690.9258 (0), 1694.9263 (0), 1706.9175 (0), 1724.9465 (0),
  2056.0513 (0), 2338.354 (0), 2354.3535 (0), 2538.3213 (0)
  }
[Click to access protein entry]
 Spot: 526 (ob21dsub)
 pI: 5.60 Mw: 37000
 %vol: 0.47913   %od: 0.272563
 ================
 *GBB2_RAT*
  accession n°: P54313

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VHAIPLR;; $m/Z=QEAEQLR;; $m/Z=AGVLAGHDNR;; $m/Z=LIIWDSYTTNK;; $m/Z=SELEQLRQEAEQLR;; $m/Z=ACcamGDSTLTQITAGLDPVGR;; $m/Z=KACcamGDSTLTQITAGLDPVGR;; $m/Z=LIIWDSYTTNKVHAIPLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 805.4714 (0), 873.4432 (0), 1009.4911 (0),
  1353.6744 (0), 1728.8495 (0), 1931.9283 (0), 2060.0132 (0),
  2140.1353 (0) }
[Click to access protein entry]
 Spot: 552 (ob21dsub)
 pI: 7.10 Mw: 33000
 %vol: 0.101095   %od: 0.149438
 ================
 *VDAC2_RAT*
  accession n°: P81155

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YQLDPTASISAK;; $m/Z=LTFDTTFSPNTGK;; $m/Z=WCcamEYGLTFTEK;; $m/Z=LTFDTTFSPNTGKK;; $m/Z=VNNSSLIGVGYTQTLRPGVK;; $m/Z=VCcamEDFDTSVNLAWTSGTNCcamTR;; $m/Z=TGDFQLHTNVNNGTEFGGSIYQK;; $m/Z=GFGFGLVK;; $m/Z=SNFAVGYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 824.4687 (0), 913.4717 (0), 1293.6932 (0),
  1428.7249 (0), 1433.67 (0), 1556.827 (0), 2103.189 (0),
  2433.0767 (0), 2527.2104 (0) }
[Click to access protein entry]
 Spot: 380 (ob21dsub)
 pI: 5.49 Mw: 50000
 %vol: 0.0849671   %od: 0.169387
 ================
 *GUAD_RAT*
  accession n°: Q9WTT6

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NYTDVYDKNNLLTNK;; $m/Z=VKPIVTPR;; $m/Z=FLYLGDDR;; $m/Z=SLTLKEVFR;; $m/Z=DFDALLINPR;; $m/Z=LATLGGSQALGLDR;; $m/Z=EWCcamFKPCcamEIR;; $m/Z=IVFLEESSQQEK;; $m/Z=FQSTDVAEEVYTR;; $m/Z=RFQSTDVAEEVYTR;; $m/Z=LAKEWCcamFKPCcamEIR;; $m/Z=FQSTDVAEEVYTRVVR;; $m/Z=GTFVHSTWTCcamPMEVLR;; $m/Z=GTFVHSTWTCcamPMoxEVLR;; $m/Z=FSLSCcamTETLMSELGNIAK;; $m/Z=FSLSCcamTETLMoxSELGNIAK;; $m/Z=IGLGTDVAGGYSYSMLDAIR;; $m/Z=IGLGTDVAGGYSYSMoxLDAIR;; $m/Z=FLYLGDDRNIEEVYVGGK;; $m/Z=EIGNFEVGKDFDALLINPR;; $m/Z=IGLGTDVAGGYSYSMLDAIRR;; $m/Z=IGLGTDVAGGYSYSMoxLDAIRR;; $m/Z=VKIGLGTDVAGGYSYSMLDAIR;; $m/Z=TVMAHGCcamYLSEEELNVFSER;; $m/Z=TVMoxAHGCcamYLSEEELNVFSER;; $m/Z=THDLYIQSHISENREEIEAVK;; $m/Z=ASDSPIDLFCcamGDFVGDISEAVIQK;; $m/Z=GASIAHCPNSNLSLSSGLLNVLDVLK;; $m/Z=NGTTTACcamYFGTIHTDSSLILAEITDKFGQR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 909.623 (0), 998.5367 (0), 1092.6841 (0),
  1173.6772 (0), 1371.8104 (0), 1424.6985 (0), 1436.7742 (0),
  1544.7799 (0), 1700.8837 (0), 1736.9229 (0), 1814.9535 (0),
  1899.025 (0), 1920.9816 (0), 1936.9711 (0), 2001.042 (0),
  2017.0361 (0), 2059.0884 (0), 2075.0872 (0), 2087.115 (0),
  2147.1814 (0), 2215.1965 (0), 2231.1865 (0), 2286.2493 (0),
  2371.1504 (0), 2387.1416 (0), 2511.3284 (0), 2583.3188 (0),
  2679.5076 (0), 3317.7339 (0) }
[Click to access protein entry]
 Spot: 172 (ob21dsub)
 pI: 5.72 Mw: 81000
 %vol: 0.0637227   %od: 0.136579
 ================
 *ACBG1_RAT*
  accession n°: Q924N5

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ELIITAGGENVPPVPIEEAVK;; $m/Z=MoxELPIISSAMoxLIGDQR;; $m/Z=DEAVYQAIHEGIQR;; $m/Z=YKDIIDSFYQEQK;; $m/Z=TIFMoxGYLNMoxEDK;; $m/Z=AASLDASEEALWTTR;; $m/Z=YGNLSALGFK;; $m/Z=ISYYQYYLIAR;; $m/Z=ANVIVVDTQK;; $m/Z=GVMoxLSQDNITWTAR;; $m/Z=GTLVNTLR;; $m/Z=EVEPTSHMoxGVPR;; $m/Z=VWEKIMER;; $m/Z=IQEVAAQSGFIR;; $m/Z=LADYLVLAR;; $m/Z=NFYGAAPMoxTAETQR;; $m/Z=FFLGLNIR;; $m/Z=LYAGYGLSESTGPHFMoxSSPYNYR;; $m/Z=LVNQDADGIGEICLWGR;; $m/Z=THEAIDSEGWLHTGDMoxGR;; $m/Z=LDDDGFLYITGR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 873.5204 (0), 979.5818 (0), 1033.6108 (0),
  1069.5688 (0), 1086.5776 (0), 1090.5435 (0), 1318.7189 (0),
  1354.6487 (0), 1384.6801 (0), 1452.7593 (0), 1493.7322 (0),
  1572.7122 (0), 1607.7758 (0), 1620.7883 (0), 1628.8048 (0),
  1676.8021 (0), 1805.8979 (0), 1915.9298 (0), 2027.8875 (0),
  2175.1648 (0), 2613.1409 (0) }
[Click to access protein entry]
 Spot: 325 (ob21dsub)
 pI: 6.23 Mw: 52000
 %vol: 0.125627   %od: 0.203598
 ================
 *FSCN1_RAT*
  accession n°: P85845

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GEHGFIGCcamR;; $m/Z=YLTAEAFGFK;; $m/Z=LINRPIIVFR;; $m/Z=YLAADKDGNVTCcamER;; $m/Z=NASCYFDIEWCER;; $m/Z=LVARPEPATGFTLEFR;; $m/Z=DVPWGVDSLITLAFQDQR;; $m/Z=SSYDVFQLEFNDGAYNIK;; $m/Z=WSVHIAMHPQVNIYSVTR;; $m/Z=WSVHIAMoxHPQVNIYSVTR;; $m/Z=QIWTLEQPPDEAGSAAVCcamLR;; $m/Z=KQIWTLEQPPDEAGSAAVCcamLR;; $m/Z=DELFALEQSCcamAQVVLQAANER;; $m/Z=QGMDLSANQDEETDQETFQLEIDR;; $m/Z=VGKDELFALEQSCcamAQVVLQAANER;; $m/Z=QGMoxDLSANQDEETDQETFQLEIDR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1032.5153 (0), 1146.6379 (0), 1240.8359 (0),
  1611.8099 (0), 1749.7249 (0), 1803.9895 (0), 2060.0601 (0),
  2109.9807 (0), 2138.1016 (0), 2154.1001 (0), 2241.1079 (0),
  2369.249 (0), 2391.2378 (0), 2675.3582 (0), 2812.2166 (0),
  2828.2476 (0) }
[Click to access protein entry]
 Spot: 608 (ob21dsub)
 pI: 5.89 Mw: 29000
 %vol: 0.0549662   %od: 0.103212
 ================
 *HPRT_RAT*
  accession n°: P27605

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SIPMoxTVDFIR;; $m/Z=TMoxQTLLSLVK;; $m/Z=SVGYRPDFVGFEIPDK;; $m/Z=FVVGYALDYNEHFR;; $m/Z=VFIPHGLIMoxDR;; $m/Z=FFADLLDYIK;; $m/Z=FFADLLDYIKALNR;; $m/Z=SIPMTVDFIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1149.6353 (0), 1178.6431 (0), 1194.6674 (0),
  1244.6938 (0), 1313.756 (0), 1698.9249 (0), 1729.9175 (0),
  1825.99 (0) }
[Click to access protein entry]
 Spot: 126 (ob21dsub)
 pI: 6.38 Mw: 95000
 %vol: 0.0848683   %od: 0.179815
 ================
 *DYN1_RAT*
  accession n°: P21575

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HIFALFNTEQR;; $m/Z=KFFLSHPSYR;; $m/Z=GMoxEDLIPLVNR;; $m/Z=LQDAFSAIGQNADLDLPQIAVVGGQSAGK;; $m/Z=SSVLENFVGR;; $m/Z=RPLVLQLVNSTTEYAEFLHCK;; $m/Z=KFTDFEEVR;; $m/Z=FTDFEEVR;; $m/Z=FTDFEEVRLEIEAETDR;; $m/Z=LEIEAETDR;; $m/Z=GISPVPINLR;; $m/Z=VYSPHVLNLTLVDLPGMoxTK;; $m/Z=VPVGDQPPDIEFQIR;; $m/Z=ENCLILAVSPANSDLANSDALK;; $m/Z=EVDPQGQR;; $m/Z=LDLMoxDEGTDAR;; $m/Z=GYIGVVNR;; $m/Z=DITAALAAER;; $m/Z=DITAALAAERK;; $m/Z=FFLSHPSYR;; $m/Z=VLNQQLTNHIR;; $m/Z=EVDEYKNFRPDDPAR;; $m/Z=NFRPDDPAR;; $m/Z=ALLQMoxVQQFAVDFEK;; $m/Z=RIEGSGDQIDTYELSGGAR;; $m/Z=IEGSGDQIDTYELSGGAR;; $m/Z=FPFELVK;; $m/Z=TGLFTPDLAFEATVK;; $m/Z=CVDMoxVVSELTSTIR;; $m/Z=LREEMoxER;; $m/Z=TSGNQDEILVIR;; $m/Z=NVYKDYR;; $m/Z=NLVDSYMoxAIVNK;; $m/Z=TIMHLMINNTK }

  peptide masses:  {  (TRYPSIN)
 too many values... }
[Click to access protein entry]
 Spot: 445 (ob21dsub)
 pI: 6.32 Mw: 44000
 %vol: 0.118575   %od: 0.179827
 ================
 *ARP2_RAT*
  accession n°: Q5M7U6

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=QEYQEKGVR;; $m/Z=HMVFLGGAVLADIMKDK;; $m/Z=QLYLER;; $m/Z=HIVLSGGSTMoxYPGLPSR;; $m/Z=LCYVGYNIEQEQK;; $m/Z=GYAFNHSADFETVR;; $m/Z=RLDIAGR;; $m/Z=DLMoxVGDEASELR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 800.4803 (0), 821.4771 (0), 1136.6011 (0),
  1350.6823 (0), 1613.7858 (0), 1643.8163 (0), 1787.9319 (0),
  1845.0548 (0) }
[Click to access protein entry]
 Spot: 293 (ob21dsub)
 pI: 5.69 Mw: 56000
 %vol: 0.0896636   %od: 0.183472
 ================
 *PDIA3_RAT*
  accession n°: P11598

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DLLTAYYDVDYEK;; $m/Z=LNFAVASR;; $m/Z=KTFSHELSDFGLESTTGEIPVVAIR;; $m/Z=TFSHELSDFGLESTTGEIPVVAIR;; $m/Z=FVMQEEFSR;; $m/Z=FVMoxQEEFSR;; $m/Z=FLQEYFDGNLKR;; $m/Z=SEPIPETNEGPVK;; $m/Z=VVVAESFDDIVNAEDK;; $m/Z=GFPTIYFSPANK;; $m/Z=GFPTIYFSPANKK;; $m/Z=ELNDFISYLQR;; $m/Z=EATNPPIIQEEKPK;; $m/Z=FIQESIFGLCPHMoxTEDNKDLIQGK;; $m/Z=FIQESIFGLCPHMTEDNKDLIQGK;; $m/Z=EYDDNGEGITIFRPLHLANKFEDK;; $m/Z=EYDDNGEGITIFRPLHLANK;; $m/Z=FAHTNVESLVK;; $m/Z=DLFSDGHSEFLK;; $m/Z=DASVVGFFR;; $m/Z=QAGPASVPLRTEDEFK;; $m/Z=QAGPASVPLR;; $m/Z=DGEEAGAYDGPR;; $m/Z=IFRDGEEAGAYDGPR;; $m/Z=LAPEYEAAATR;; $m/Z=RLAPEYEAAATR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 877.5047 (0), 995.582 (0), 997.5331 (0), 1172.564 (0),
  1188.5461 (0), 1191.6088 (0), 1236.5364 (0), 1244.6736 (0),
  1341.6906 (0), 1347.7179 (0), 1394.6753 (0), 1396.6892 (0),
  1397.7247 (0), 1469.7882 (0), 1529.7894 (0), 1593.8446 (0),
  1607.756 (0), 1652.7743 (0), 1744.906 (0), 1749.8253 (0),
  2302.1479 (0), 2605.304 (0), 2733.3958 (0), 2820.3486 (0),
  2821.356 (0), 2836.3462 (0) }
[Click to access protein entry]
 Spot: 170 (ob21dsub)
 pI: 6.78 Mw: 82000
 %vol: 0.177487   %od: 0.169045
 ================
 *TRFE_RAT*
  accession n°: P12346

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DLLFKDSAFGCYGVPPR;; $m/Z=WCAVSEHENTK;; $m/Z=TVLPADGPR;; $m/Z=GTDFQLNQLQGKK;; $m/Z=HTTIFEVLPQK;; $m/Z=ADRDQYELLCLDNTR;; $m/Z=DQYELLCLDNTR;; $m/Z=KPVDQYEDCYLAR;; $m/Z=IPSHAVVAR;; $m/Z=VAQEHFGK;; $m/Z=SKDFQLFGSPLGK;; $m/Z=DFQLFGSPLGK;; $m/Z=DSAFGCYGVPPRMoxDYR;; $m/Z=LYLGHSYVTAIR;; $m/Z=WCALSHQER;; $m/Z=ASDSSINWNNLK;; $m/Z=TAGWNIPMoxGLLFSR;; $m/Z=FDEFFSQGCAPGYK;; $m/Z=EGYNGYTGAFQCLVEK;; $m/Z=KPVTEFATCHLAQAPNHVVVSR;; $m/Z=GDKDCTGNFCLFR;; $m/Z=DCTGNFCLFR;; $m/Z=DLLFRDDTK;; $m/Z=LPEGTTYEEYLGAEYLQAVGNIR;; $m/Z=LLEACTFHK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 915.4411 (0), 925.4881 (0), 949.5349 (0), 1118.533 (0),
  1122.5493 (0), 1186.5139 (0), 1208.5782 (0), 1289.5109 (0),
  1312.6697 (0), 1348.6101 (0), 1360.5787 (0), 1392.7249 (0),
  1423.7012 (0), 1476.7178 (0), 1539.6661 (0), 1578.7509 (0),
  1589.6393 (0), 1652.6331 (0), 1656.7164 (0), 1835.7599 (0),
  1881.8092 (0), 1906.8408 (0), 1941.9387 (0), 2461.1853 (0),
  2586.1716 (0) }
[Click to access protein entry]
 Spot: 71 (ob21dsub)
 pI: 6.23 Mw: 95000
 %vol: 0.06897   %od: 0.218769
 ================
 *PYC_RAT*
  accession n°: P52873

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VVKGQPLCVLSAMoxK;; $m/Z=TVAVYSEQDTGQMoxHR;; $m/Z=QKADEAYLIGR;; $m/Z=ADEAYLIGR;; $m/Z=GLAPVQAYLHIPDIIK;; $m/Z=ENGVDAVHPGYGFLSER;; $m/Z=ADFAQACQDAGVR;; $m/Z=FIGPSPEVVR;; $m/Z=VVHSYEELEENYTR;; $m/Z=HIEVQILGDQYGNILHLYER;; $m/Z=VVEIAPATHLDPQLR;; $m/Z=LQVEHTVTEEITDVDLVHAQIHVSEGR;; $m/Z=SLPDLGLR;; $m/Z=SFQPDTGR;; $m/Z=LDNASAFQGAVISPHYDSLLVK;; $m/Z=VSPSPVDPIVPVVPIGPPPAGFR;; $m/Z=EGPEGFAR;; $m/Z=NHQGLLLMoxDTTFR;; $m/Z=DAHQSLLATR;; $m/Z=FLYECPWR;; $m/Z=GANAVGYTNYPDNVVFK;; $m/Z=YSLEYYMoxGLAEELVR;; $m/Z=GTPLDTEVPLER;; $m/Z=VFDYSEYWEGAR;; $m/Z=IVGDLAQFMoxVQNGLSR;; $m/Z=AEAEAQAEELSFPR;; $m/Z=SVVEFLQGYIGIPHGGFPEPFR;; $m/Z=DFTATFGPLDSLNTR;; $m/Z=IAEEFEVELER;; $m/Z=QVFFELNGQLR;; $m/Z=QVFFELNGQLRSILVK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 862.4372 (0), 870.534 (0), 907.4689 (0), 1007.5534 (0),
  1100.652 (0), 1111.62 (0), 1170.5881 (0), 1263.7291 (0),
  1326.7367 (0), 1350.7659 (0), 1363.7211 (0), 1408.6908 (0),
  1521.7258 (0), 1545.8357 (0), 1547.7919 (0), 1561.8302 (0),
  1654.8622 (0), 1658.9716 (0), 1737.8397 (0), 1748.0359 (0),
  1763.9436 (0), 1767.8802 (0), 1828.9249 (0), 1846.9331 (0),
  1851.9351 (0), 1891.0332 (0), 2294.3582 (0), 2345.2627 (0),
  2410.3196 (0), 2446.3245 (0), 3054.6045 (0)
  }
[Click to access protein entry]
 Spot: 382 (ob21dsub)
 pI: 5.47 Mw: 50000
 %vol: 0.201762   %od: 0.21024
 ================
 *QCR1_RAT*
  accession n°: Q68FY0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YFYDQCPAVAGYGPIEQLSDYNR;; $m/Z=SGMFWLR;; $m/Z=SGMoxFWLR;; $m/Z=EVESIGAHLNAYSTR;; $m/Z=NNGAGYFLEHLAFK;; $m/Z=VASEQSSHPTCTVGVWIDVGSR;; $m/Z=NRPGNALEK;; $m/Z=VVELLADIVQNISLEDSQIEK;; $m/Z=TDLTDYLSR;; $m/Z=APRMoxVLAAAGGVK;; $m/Z=LCTSATESEVTR;; $m/Z=NALISHLDGTTPVCEDIGR;; $m/Z=SLLTYGR;; $m/Z=IPLAEWESR;; $m/Z=IEEVDAQMVR;; $m/Z=IEEVDAQMoxVR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 809.4629 (0), 896.4736 (0), 912.4621 (0), 998.5704 (0),
  1083.5653 (0), 1100.6096 (0), 1189.631 (0), 1205.6108 (0),
  1256.7046 (0), 1353.6733 (0), 1580.8124 (0), 1646.8444 (0),
  2068.0413 (0), 2355.2837 (0), 2372.1519 (0), 2726.2427 (0)
  }
[Click to access protein entry]
 Spot: 596 (ob21dsub)
 pI: 4.63 Mw: 29000
 %vol: 0.358553   %od: 0.236476
 ================
 *1433E_RAT*
  accession n°: P62260

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LGLALNFSVFYYEILNSPDR;; $m/Z=NLLSVAYK;; $m/Z=DSTLIMQLLR;; $m/Z=DSTLIMoxQLLR;; $m/Z=YLAEFATGNDR;; $m/Z=YLAEFATGNDRK;; $m/Z=VAGMDVELTVEER;; $m/Z=VAGMoxDVELTVEER;; $m/Z=LICcamCcamDILDVLDK;; $m/Z=AASDIAMTELPPTHPIR;; $m/Z=AASDIAMoxTELPPTHPIR;; $m/Z=LAEQAERYDEMVESMK;; $m/Z=AAFDDAIAELDTLSEESYK;; $m/Z=AAPDDAIAELDTLSEESYKDSTLIMoxQLLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 907.4849 (0), 1189.6173 (0), 1205.6107 (0),
  1256.5519 (0), 1384.6464 (0), 1447.6669 (0), 1463.6624 (0),
  1476.697 (0), 1819.8889 (0), 1835.8806 (0), 1928.8816 (0),
  2087.9121 (0), 2331.1462 (0), 3274.5623 (0)
  }
[Click to access protein entry]
 Spot: 454 (ob21dsub)
 pI: 5.56 Mw: 43000
 %vol: 0.0300095   %od: 0.104415
 ================
 *TMOD2_RAT*
  accession n°: P70566

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MALPFQK;; $m/Z=EHLLMYLEKEALEQK;; $m/Z=KFSLAATR;; $m/Z=SNDPVALAFAEMoxLK;; $m/Z=SLNVESNFITGAGILALVEALR;; $m/Z=QQLGTAVEMoxEIAQMoxLEENSR;; $m/Z=FGYQFTK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 834.4561 (0), 890.4776 (0), 893.5509 (0), 1521.799 (0),
  1874.0107 (0), 2287.3181 (0), 2309.1094 (0)
  }
[Click to access protein entry]
 Spot: 419 (ob21dsub)
 pI: 6.37 Mw: 46000
 %vol: 0.161765   %od: 0.199894
 ================
 *GLNA_RAT*
  accession n°: P09606

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ITGTNAEVMoxPAQWEFQIGPCcamEGIR;; $m/Z=HQYHIR;; $m/Z=KGYFEDR;; $m/Z=DIVEAHYR;; $m/Z=MGDHLWVAR;; $m/Z=MoxGDHLWVAR;; $m/Z=IQLMYIWVDGTGEGLR;; $m/Z=IQLMoxYIWVDGTGEGLR;; $m/Z=RPSANCcamDPYAVTEAIVR;; $m/Z=LTGFHETSNINDFSAGVANR;; $m/Z=RLTGFHETSNINDFSAGVANR;; $m/Z=ITGTNAEVMPAQWEFQIGPCcamEGIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 853.4401 (0), 914.4701 (0), 1002.503 (0),
  1084.5435 (0), 1100.5308 (0), 1850.9331 (0), 1866.9597 (0),
  1918.9591 (0), 2150.0439 (0), 2306.1443 (0), 2704.3025 (0),
  2720.3213 (0) }
[Click to access protein entry]
 Spot: 553 (ob21dsub)
 pI: 8.50 Mw: 32000
 %vol: 0.259945   %od: 0.204872
 ================
 *VDAC1_RAT*
  accession n°: Q9Z2L0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GYGFGLIK;; $m/Z=WNTDNTLGTEITVEDQLAR;; $m/Z=LTFDSSFSPNTGK;; $m/Z=LTFDSSFSPNTGKK;; $m/Z=EHINLGCDVDFDIAGPSIR;; $m/Z=VTQSNFAVGYK;; $m/Z=TDEFQLHTNVNDGTEFGGSIYQK;; $m/Z=KLETAVNLAWTAGNSNTR;; $m/Z=VNNSSLIGLGYTQTLKPGIK;; $m/Z=WTEYGLTFTEK;; $m/Z=GYGFGLIKLDLK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 854.5046 (0), 1213.6545 (0), 1323.7013 (0),
  1374.6987 (0), 1400.6979 (0), 1528.8002 (0), 1946.054 (0),
  2103.2114 (0), 2128.062 (0), 2176.0913 (0), 2600.2192 (0)
  }
[Click to access protein entry]
 Spot: 472 (ob21dsub)
 pI: 6.01 Mw: 41000
 %vol: 0.085754   %od: 0.0988586
 ================
 *TALDO_RAT*
  accession n°: Q9EQS0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=WLHNEDQMAVEK;; $m/Z=WLHNEDQMoxAVEK;; $m/Z=SYEPQEDPGVK;; $m/Z=LGGPQEEQIK;; $m/Z=LFVLFGAEILK;; $m/Z=VSTEVDAR;; $m/Z=LSFDKDAMVAR,111-121;; $m/Z=LSFDKDAMoxVAR;; $m/Z=RIIELYK;; $m/Z=EAGISKDR;; $m/Z=ILDWHVANTDK;; $m/Z=IYNYYK;; $m/Z=TIVMGASFR;; $m/Z=TIVMoxGASFR;; $m/Z=NTGEIKALAGCDFLTISPK;; $m/Z=ALAGCDFLTISPK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 863.4634 (0), 875.4875 (0), 876.4827 (0), 934.609 (0),
  981.5625 (0), 997.5508 (0), 1098.6207 (0), 1248.6344 (0),
  1249.7418 (0), 1252.6976 (0), 1268.6854 (0), 1311.7158 (0),
  1392.7621 (0), 1499.7548 (0), 1515.7329 (0), 2035.0709 (0)
  }
[Click to access protein entry]
 Spot: 43 (ob21dsub)
 pI: 5.50 Mw: 191000
 %vol: 0.133518   %od: 0.143079
 ================
 *CLH_RAT*
  accession n°: P11442

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HSSLAGCQIINYR;; $m/Z=VGEQAQVVIIDMoxNDPSNPIR;; $m/Z=WLLLTGISAQQNR;; $m/Z=MEGNAEESTLFCFAVR;; $m/Z=MoxEGNAEESTLFCFAVR;; $m/Z=YGYIHLYDLETGTCIYMNR;; $m/Z=YGYIHLYDLETGTCIYMoxNR;; $m/Z=ISGETIFVTAPHEATAGIIGVNR;; $m/Z=NNLAGAEELFAR;; $m/Z=KFNALFAQGNYSEAAK;; $m/Z=YESLELCRPVLQQGR;; $m/Z=SVDPTLALSVYLR;; $m/Z=VIQCFAETGQVQKIVLYAK;; $m/Z=NNRPSEGPLQTR;; $m/Z=AHIAQLCEK;; $m/Z=ALEHFTDLYDIK;; $m/Z=LTDQLPLIIVCDR;; $m/Z=FDFVHDLVLYLYR;; $m/Z=NLILVVR;; $m/Z=GQCDLELINVCNENSLFK;; $m/Z=KDPELWGSVLLESNPYR;; $m/Z=DPELWGSVLLESNPYR;; $m/Z=NLQNLLILTAIK;; $m/Z=KFDVNTSAVQVLIEHIGNLDR;; $m/Z=GMVKEAIDSYIK;; $m/Z=LAELEEFINGPNNAHIQQVGDR;; $m/Z=LASTLVHLGEYQAAVDGAR;; $m/Z=AHMGMoxFTELAILYSKFKPQK;; $m/Z=MoxREHLELFWSR;; $m/Z=EHLELFWSR;; $m/Z=AVNYFSKVK;; $m/Z=QLPLVKPYLR;; $m/Z=SVQNHNNK;; $m/Z=TSIDAYDNFDNISLAQR }

  peptide masses:  {  (TRYPSIN)
 too many values... }
[Click to access protein entry]
 Spot: 484 (ob21dsub)
 pI: 5.54 Mw: 41000
 %vol: 0.0468548   %od: 0.123373
 ================
 *IDH3A_RAT*
  accession n°: Q99NA5

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ENTEGEYSGIEHVIVDGVVQSIK;; $m/Z=DMoxANPTALLLSAVMoxMoxLR;; $m/Z=TPIAAGHPSMoxNLLLR;; $m/Z=TPYTDVNIVTIR;; $m/Z=RIAEFAFEYAR;; $m/Z=IAEFAFEYAR;; $m/Z=MRPGVAAVAAVR;; $m/Z=APIQWEER }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1028.5192 (0), 1197.6613 (0), 1216.6011 (0),
  1372.7043 (0), 1391.7626 (0), 1606.8683 (0), 1894.9451 (0),
  2502.2346 (0) }
[Click to access protein entry]
 Spot: 389 (ob21dsub)
 pI: 7.00 Mw: 50000
 %vol: 0.0308781   %od: 0.0776417
 ================
 *PRS8_RAT*
  accession n°: P62198

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VHVTQEDFEMAVAK;; $m/Z=IEELQLIVNDK;; $m/Z=LLREELQLLQEQGSYVGEVVR;; $m/Z=EELQLLQEQGSYVGEVVR;; $m/Z=NIDINDVTPNCR;; $m/Z=HPELFEALGIAQPK;; $m/Z=GVLLYGPPGTGK;; $m/Z=ELFVMoxAR;; $m/Z=EHAPSIIFMoxDEIDSIGSSR;; $m/Z=LEGGSGGDSEVQR;; $m/Z=IDILDSALLRPGR;; $m/Z=KIEFPPPNEEAR;; $m/Z=IEFPPPNEEAR;; $m/Z=RVHVTQEDFEMoxAVAK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 881.452 (0), 1158.6416 (0), 1290.6187 (0),
  1298.6628 (0), 1313.7192 (0), 1426.7578 (0), 1430.7146 (0),
  1438.8561 (0), 1549.8412 (0), 1603.7368 (0), 1775.8915 (0),
  2076.0903 (0), 2120.0139 (0), 2458.3613 (0)
  }
[Click to access protein entry]
 Spot: 753 (ob21dsub)
 pI: 5.49 Mw: 18000
 %vol: 0.166655   %od: 0.119716
 ================
 *STMN1_RAT*
  accession n°: P13668

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=RASGQAFELILSPR;; $m/Z=ASGQAFELILSPR;; $m/Z=SKESVPEFPLSPPK;; $m/Z=ESVPEFPLSPPK;; $m/Z=DLSLEEIQK;; $m/Z=KLEAAEER;; $m/Z=LEAAEER;; $m/Z=SHEAEVLK;; $m/Z=EHEKEVLQK;; $m/Z=DKHVEEVR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 817.4343 (0), 912.5045 (0), 945.5344 (0), 1011.562 (0),
  1074.5931 (0), 1139.6508 (0), 1326.7207 (0), 1388.7915 (0),
  1541.8477 (0), 1544.8901 (0) }
[Click to access protein entry]
 Spot: 450 (ob21dsub)
 pI: 6.40 Mw: 43000
 %vol: 0.216714   %od: 0.181868
 ================
 *MK01_RAT*
  accession n°: P63086

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VADPDHDHTGFLTEYVATR;; $m/Z=KISPFEHQTYCQR;; $m/Z=ISPFEHQTYCQR;; $m/Z=FRHENIIGINDIIR;; $m/Z=HENIIGINDIIR;; $m/Z=DVYIVQDLMoxETDLYK;; $m/Z=YIHSANVLHR;; $m/Z=ICDFGLAR;; $m/Z=APEIMLNSK;; $m/Z=NYLLSLPHK;; $m/Z=NKVPWNR;; $m/Z=MoxLTFNPHKR;; $m/Z=LKELIFEETAR;; $m/Z=ELIFEETAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 913.506 (0), 951.4861 (0), 1002.5187 (0),
  1084.6163 (0), 1107.5846 (0), 1159.6184 (0), 1209.6671 (0),
  1348.7697 (0), 1406.7823 (0), 1565.751 (0), 1693.896 (0),
  1709.9717 (0), 1860.9097 (0), 2144.0271 (0)
  }
[Click to access protein entry]
 Spot: 285 (ob21dsub)
 pI: 7.10 Mw: 57000
 %vol: 0.117154   %od: 0.171062
 ================
 *KPYM_RAT*
  accession n°: P11980

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LLFEELAR;; $m/Z=IYVDDGLISLQVK;; $m/Z=LDIDSAPITAR;; $m/Z=NTGIICTIGPASR;; $m/Z=LNFSHGTHEYHAETIK;; $m/Z=AATESFASDPILYRPVAVALDTK;; $m/Z=GADYLVTEVENGGSLGSK;; $m/Z=FGVEQDVDMoxVFASFIR;; $m/Z=IENHEGVR;; $m/Z=RFDEILEASDGIMoxVAR;; $m/Z=FDEILEASDGIMoxVAR;; $m/Z=GDLGIEIPAEK;; $m/Z=GDLGIEIPAEKVFLAQK;; $m/Z=GDYPLEAVR;; $m/Z=EAEAAVFHR;; $m/Z=CLAAALIVLTESGR;; $m/Z=DAVLDAWAEDVDLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 953.5161 (0), 990.5948 (0), 1019.5483 (0),
  1029.5464 (0), 1141.616 (0), 1171.6705 (0), 1359.7532 (0),
  1462.8383 (0), 1473.8452 (0), 1587.8079 (0), 1681.8639 (0),
  1795.9104 (0), 1827.942 (0), 1837.9523 (0), 1875.9315 (0),
  1883.9381 (0), 2435.3215 (0) }
[Click to access protein entry]
 Spot: 80 (ob21dsub)
 pI: 5.91 Mw: 95000
 %vol: 0.070084   %od: 0.189878
 ================
 *VINC_RAT*
  accession n°: P85972

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MoxALLMoxAEMSR;; $m/Z=AIPDLTAPVAAVQAAVSNLVR;; $m/Z=LVQAAQMoxLQSDPYSVPAR;; $m/Z=DYLIDGSR;; $m/Z=GILSGTSDLLLTFDEAEVR;; $m/Z=MoxSAEINEIIR;; $m/Z=GWLRDPNASPGDAGEQAIR;; $m/Z=DPNASPGDAGEQAIR;; $m/Z=MoxLGQMTDQVADLR;; $m/Z=AQQVSQGLDVLTAK;; $m/Z=KIDAAQNWLADPNGGPEGEEQIR;; $m/Z=WIDNPTVDDR;; $m/Z=LANVMoxMoxGPYR;; $m/Z=LANVMoxMoxGPYRQDLLAK;; $m/Z=CDRVDQLAAQLADLAAR;; $m/Z=VDQLAAQLADLAAR;; $m/Z=ALASQLQDSLK;; $m/Z=LLAVAATAPPDAPNREEVFDER;; $m/Z=EEVFDER;; $m/Z=AANFENHSGR;; $m/Z=NPGNQAAYEHFETMoxK;; $m/Z=NQWIDNVEK;; $m/Z=SFLDSGYR;; $m/Z=EAFQPQEPDFPPPPPDLEQLR;; $m/Z=LTDELAPPKPPLPEGEVPPPRPPPPEEK;; $m/Z=AGEVINQPMoxMoxMoxAAR;; $m/Z=TNLLQVCER;; $m/Z=IRTDAGFTLR;; $m/Z=TDAGFTLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 880.4266 (0), 923.4111 (0), 938.4394 (0), 944.4312 (0),
  1102.4844 (0), 1132.5538 (0), 1145.5204 (0), 1149.5865 (0),
  1173.5923 (0), 1183.5134 (0), 1184.6041 (0), 1191.5702 (0),
  1230.5651 (0), 1454.7544 (0), 1457.7324 (0), 1497.6552 (0),
  1509.6427 (0), 1566.6321 (0), 1752.7021 (0), 1851.8628 (0),
  1885.8774 (0), 1989.911 (0), 2009.9214 (0), 2035.9873 (0),
  2076.0969 (0), 2381.1074 (0), 2447.1025 (0), 2508.1091 (0),
  3023.4866 (0) }
[Click to access protein entry]
 Spot: 768 (ob21dsub)
 pI: 8.60 Mw: 18000
 %vol: 0.418775   %od: 0.235863
 ================
 *PPIA_RAT*
  accession n°: P10111

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VNPTVFFDITADGEPLGR;; $m/Z=SIYGEKFEDENFILK;; $m/Z=IIPGFMoxCcamQGGDFTR;; $m/Z=IIPGFMCcamQGGDFTR;; $m/Z=EGMoxSIVEAMoxER;; $m/Z=EGMoxSIVEAMER;; $m/Z=FEDENFILK;; $m/Z=KITISDCcamGQL;; $m/Z=VCcamFELFADK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1128.496 (0), 1134.5337 (0), 1154.5204 (0),
  1267.5133 (0), 1283.5088 (0), 1598.7012 (0), 1614.6968 (0),
  1831.8596 (0), 1947.9381 (0) }
[Click to access protein entry]
 Spot: 298 (ob21dsub)
 pI: 5.53 Mw: 56000
 %vol: 0.203825   %od: 0.197876
 ================
 *CH60_RAT*
  accession n°: P63039

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VTDALNATR;; $m/Z=IQEITEQLDITTSEYEK;; $m/Z=APGFGDNRK;; $m/Z=APGFGDNR;; $m/Z=KPLVIIAEDVDGEALSTLVLNR;; $m/Z=TVIIEQSWGSPK;; $m/Z=LVQDVANNTNEEAGDGTTTATVLAR;; $m/Z=GANPVEIR;; $m/Z=TLNDELEIIEGMoxKFDR;; $m/Z=GYISPYFINTSK;; $m/Z=CEFQDAYVLLSEK;; $m/Z=KISSVQSIVPALEIANAHR;; $m/Z=LPTVLRQMoxRPVSR;; $m/Z=ISSVQSIVPALEIANAHR;; $m/Z=IGIEIIKR;; $m/Z=AAVEEGIVLGGGCALLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 833.4089 (0), 855.4838 (0), 941.6365 (0), 960.5367 (0),
  961.5171 (0), 1344.7308 (0), 1389.7172 (0), 1568.8274 (0),
  1601.7863 (0), 1684.9236 (0), 1905.0734 (0), 1938.9646 (0),
  2033.1625 (0), 2040.0134 (0), 2365.3452 (0), 2560.2549 (0)
  }
[Click to access protein entry]
 Spot: 787 (ob21dsub)
 pI: 6.36 Mw: 78000
 %vol: 0.0473566   %od: 0.188734
 ================
 *MOES_RAT*
  accession n°: O35763

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=KAPDFVFYAPR;; $m/Z=LFFLQVK;; $m/Z=QLFDQVVK;; $m/Z=EDAVLEYLK;; $m/Z=IGFPWSEIR;; $m/Z=ESPLLFKFR;; $m/Z=APDFVFYAPR;; $m/Z=IQVWHEEHR;; $m/Z=RKPDTIEVQQMoxK;; $m/Z=GMoxLREDAVLEYLK;; $m/Z=EVWFFGLQYQDTK;; $m/Z=VTTMoxDAELEFAIQPNTTGK;; $m/Z=GSELWLGVDALGLNIYEQNDR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 894.5776 (0), 976.563 (0), 1079.6053 (0), 1104.632 (0),
  1136.6279 (0), 1182.6427 (0), 1233.6694 (0), 1310.7438 (0),
  1488.8334 (0), 1552.8654 (0), 1660.8607 (0), 2082.0764 (0),
  2362.2434 (0) }
[Click to access protein entry]
 Spot: 656 (ob21dsub)
 pI: 5.72 Mw: 25000
 %vol: 0.0917331   %od: 0.120659
 ================
 *PRDX6_RAT*
  accession n°: O35244

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LSILYPATTGR;; $m/Z=LPFPIIDDKDR;; $m/Z=DFTPVCcamTTELGR;; $m/Z=FHDFLGDSWGILFSHPR;; $m/Z=PGGLLLGDEAPNFEANTTIGHIR;; $m/Z=NFDEILR;; $m/Z=VVFIFGPDK;; $m/Z=LPFPIIDDK;; $m/Z=VVFIFGPDKK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 906.4429 (0), 1021.5461 (0), 1057.5662 (0),
  1149.6332 (0), 1191.6484 (0), 1328.6996 (0), 1395.6422 (0),
  2030.9681 (0), 2392.2058 (0) }
[Click to access protein entry]
 Spot: 85 (ob21dsub)
 pI: 5.36 Mw: 95000
 %vol: 0.125514   %od: 0.168467
 ================
 *HSP74_RAT*
  accession n°: O88600

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FQESEERPK;; $m/Z=TSTVDLPIESQLLWQLDR;; $m/Z=AGGIETIANEYSDR;; $m/Z=SQVISNAKNTVQGFK;; $m/Z=AFSDPFVEAEK;; $m/Z=SNLAYDIVQLPTGLTGIK;; $m/Z=KPVVDCVVSVPSFYTDAER;; $m/Z=SVMoxDATQIAGLNCLR;; $m/Z=QDLPALEEKPR;; $m/Z=NVVFVDMoxGHSAYQVSVCAFNR;; $m/Z=VLATAFDTTLGGR;; $m/Z=FDEVLVNHFCEEFGKK;; $m/Z=ELSTTLNADEAVTR;; $m/Z=EFSITDVVPYPISLR;; $m/Z=VREFSITDVVPYPISLR;; $m/Z=VNVHGIFSVSSAALVEVHK;; $m/Z=NAVEEYVYEMoxR;; $m/Z=FVSEDDRNNFTLK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1149.6019 (0), 1239.632 (0), 1295.738 (0),
  1321.752 (0), 1418.6694 (0), 1495.7637 (0), 1519.8142 (0),
  1584.8109 (0), 1620.8981 (0), 1664.8459 (0), 1735.9684 (0),
  1903.0814 (0), 1991.1349 (0), 1993.1306 (0), 1998.0066 (0),
  2114.1548 (0), 2168.1152 (0), 2416.196 (0)
  }
[Click to access protein entry]
 Spot: 238 (ob21dsub)
 pI: 6.34 Mw: 66000
 %vol: 0.0637574   %od: 0.197676
 ================
 *WDR1_RAT*
  accession n°: Q5RKI0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MoxTVDESGQLVSCSMDDTVR;; $m/Z=YTNLTLR;; $m/Z=CFSIDNPGYEPEVVAVHPGGDTVAVGGSDGNVR;; $m/Z=VYSILGATLKDEGK;; $m/Z=GPVTDLAYSHDGAFLAVCDASK;; $m/Z=VVTVFSVADGYSENNVFYGHHAK;; $m/Z=LHHVSSLAWLDEHTLVTTSHDASVK;; $m/Z=NIDNPAVADIYTEHAHQVVVAK;; $m/Z=VFASLPQVER;; $m/Z=KVFASLPQVER;; $m/Z=YAPSGFYIASGDISGK;; $m/Z=YEYQPFAGK;; $m/Z=IWDTTQK;; $m/Z=FGAVFLWDTGSSVGEITGHNK;; $m/Z=LATGSDDNCAAFFEGPPFK;; $m/Z=FTIGDHSR;; $m/Z=FATASADGQIFIYDGK;; $m/Z=AHDGGIYAISWSPDSTHLLSASGDK;; $m/Z=DHLLSISLSGYINYLDKNNPSKPLR;; $m/Z=SYIYSGSHDGHINYWDSETGENDSFSGK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 880.4777 (0), 891.4313 (0), 932.4599 (0),
  1102.5022 (0), 1145.6281 (0), 1273.698 (0), 1493.7502 (0),
  1632.7426 (0), 1703.7698 (0), 2043.906 (0), 2161.8396 (0),
  2222.0269 (0), 2294.0056 (0), 2404.1548 (0), 2540.1492 (0),
  2585.1492 (0), 2783.3323 (0), 2857.4409 (0), 3152.2119 (0),
  3371.4529 (0) }
[Click to access protein entry]
 Spot: 501 (ob21dsub)
 pI: 4.95 Mw: 40000
 %vol: 0.178683   %od: 0.136461
 ================
 *NPM_RAT*
  accession n°: P13084

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GPSSVEDIKAK;; $m/Z=VDNDENEHQLSLR;; $m/Z=MoxTDQEAIQDLWQWR;; $m/Z=MoxSVQPTVSLGGFEITPPVVLR;; $m/Z=GPSSVEDIK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 931.4704 (0), 1130.6139 (0), 1568.751 (0),
  1835.8663 (0), 2243.2417 (0) }
[Click to access protein entry]
 Spot: 233 (ob21dsub)
 pI: 5.95 Mw: 67000
 %vol: 0.131483   %od: 0.214852
 ================
 *AMPB_RAT*
  accession n°: O09175

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YTLPLYHAMoxMoxGGSEMoxAR;; $m/Z=ISNAQNAELR;; $m/Z=SPLPPGNVK;; $m/Z=TYQLVYFLDK;; $m/Z=GVDSIPGFEFNR;; $m/Z=KGVDSIPGFEFNR;; $m/Z=LFGPYVWGR;; $m/Z=KPFVYTQGQAVLNR;; $m/Z=KKPFVYTQGQAVLNR;; $m/Z=FRLELTYR;; $m/Z=CLLPEGASELR;; $m/Z=AEFGPPGPGPGSR;; $m/Z=AFEILHLHLDLR;; $m/Z=RPLHSAQAVDVASASSFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 908.5314 (0), 1094.6263 (0), 1097.649 (0),
  1115.6259 (0), 1225.6444 (0), 1244.6754 (0), 1289.7131 (0),
  1337.6941 (0), 1465.8052 (0), 1476.8682 (0), 1620.9379 (0),
  1749.035 (0), 1899.0383 (0), 1975.9305 (0)
  }
[Click to access protein entry]
 Spot: 669 (ob21dsub)
 pI: 5.88 Mw: 23000
 %vol: 0.10812   %od: 0.108166
 ================
 *PRDX3_RAT*
  accession n°: Q9Z0V6

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GTAVVNGEFK;; $m/Z=ELSLDDFK;; $m/Z=NGGLGHMoxNITLLSDLTK;; $m/Z=DYGVLLESAGIALR;; $m/Z=GLFIIDPNGVIK;; $m/Z=HLSVNDLPVGR;; $m/Z=SVEETLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 833.4358 (0), 966.4859 (0), 1021.5372 (0),
  1206.6731 (0), 1285.7533 (0), 1476.8206 (0), 1799.9293 (0)
  }
[Click to access protein entry]
 Spot: 156 (ob21dsub)
 pI: 7.20 Mw: 83000
 %vol: 0.421487   %od: 0.291214
 ================
 *ACON_RAT*
  accession n°: Q9ER34

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HPNGTQETILLNHTFNETQIEWFR;; $m/Z=FKLEAPDADELPR;; $m/Z=LEAPDADELPR;; $m/Z=VDVSPTSQR;; $m/Z=LQLLEPFDKWDGK;; $m/Z=CTTDHISAAGPWLK;; $m/Z=NAVTQEFGPVPDTAR;; $m/Z=EHAALEPR;; $m/Z=QGLLPLTFADPSDYNK;; $m/Z=DFAPGKPLNCIIK;; $m/Z=FNPETDFLTGK;; $m/Z=NTIVTSYNR;; $m/Z=DVGGIVLANACGPCIGQWDR;; $m/Z=DGYAQILR;; $m/Z=SQFTITPGSEQIR;; $m/Z=VGLIGSCTNSSYEDMoxGR;; $m/Z=EGWPLDIR;; $m/Z=LTGTLSGWTSPK;; $m/Z=DINQEVYNFLATAGAK;; $m/Z=VAVPSTIHCDHLIEAQLGGEK;; $m/Z=IVYGHLDDPANQEIER;; $m/Z=LNRPLTLSEK;; $m/Z=RLNRPLTLSEK;; $m/Z=VAMoxSHFEPSEYIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 922.5011 (0), 935.5228 (0), 985.5403 (0), 988.54 (0),
  1067.5808 (0), 1170.7209 (0), 1225.6442 (0), 1247.6896 (0),
  1268.6429 (0), 1326.8232 (0), 1463.7933 (0), 1472.8177 (0),
  1500.8105 (0), 1556.795 (0), 1581.7802 (0), 1588.8549 (0),
  1601.8369 (0), 1753.9049 (0), 1778.9231 (0), 1861.8534 (0),
  1868.9618 (0), 2158.0754 (0), 2274.1963 (0), 2925.4746 (0)
  }
[Click to access protein entry]
 Spot: 705 (ob21dsub)
 pI: 5.08 Mw: 20000
 %vol: 0.0936911   %od: 0.119114
 ================
 *PSB6_RAT*
  accession n°: P28073

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DGSSGGVIR;; $m/Z=DGSSGGVIRLAAIQQSGVER;; $m/Z=LAAIQQSGVER;; $m/Z=QVLLGDQIPK;; $m/Z=DECLQFTANALALAMoxER;; $m/Z=DECLQFTANALALAMER;; $m/Z=QSFAIGGSGSSYIYGYVDATYR;; $m/Z=LTPIHDHIFCCR;; $m/Z=TTTGSYIANR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 847.4476 (0), 1083.5735 (0), 1110.6586 (0),
  1171.6763 (0), 1568.7886 (0), 1953.0052 (0), 1968.9802 (0),
  1999.9823 (0), 2362.146 (0) }
[Click to access protein entry]
 Spot: 61 (ob21dsub)
 pI: 5.92 Mw: 120000
 %vol: 0.0594434   %od: 0.182764
 ================
 *LPPRC_RAT*
  accession n°: Q5SGE0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=QYFHQLR;; $m/Z=DAAVLSFFHILNGAALR;; $m/Z=LQWFCDR;; $m/Z=LFECDRDQMoxYYNLLK;; $m/Z=TSNQEVPFDVPELWFGDDR;; $m/Z=GFTLNGAASSLLIIAQVR;; $m/Z=AALDLEQVPSELAVTR;; $m/Z=TLLELIPELR;; $m/Z=SMoxNIDLWSK;; $m/Z=RSMoxNIDLWSK;; $m/Z=GSLILGFR;; $m/Z=THYFWPLLVGHQK;; $m/Z=AVMoxEALRDEGFPIR;; $m/Z=SIPDAMNLILLLVTEK;; $m/Z=AGYPQYVSEILEK;; $m/Z=DLPITEAVFSALVTGHAR;; $m/Z=MoxEGANIQPNR;; $m/Z=VYLQNEYR;; $m/Z=SCGSLLPELSLAER;; $m/Z=SGSPGSNQALLLLR;; $m/Z=SGSQFDWALMoxR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 862.4802 (0), 991.4863 (0), 1024.4456 (0),
  1084.5225 (0), 1109.5259 (0), 1145.5322 (0), 1196.7026 (0),
  1265.6384 (0), 1313.5768 (0), 1412.7637 (0), 1496.7327 (0),
  1531.7599 (0), 1619.8054 (0), 1625.8417 (0), 1711.9103 (0),
  1769.9979 (0), 1814.9792 (0), 1831.0173 (0), 1897.0079 (0),
  2023.9202 (0), 2251.0254 (0) }
[Click to access protein entry]
 Spot: 189 (ob21dsub)
 pI: 6.38 Mw: 78000
 %vol: 0.0963828   %od: 0.202984
 ================
 *NSF_RAT*
  accession n°: Q9QUL6

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LLDYVPIGPR;; $m/Z=KFLALMoxR;; $m/Z=DYQSGQHVMVR;; $m/Z=YIFTLR;; $m/Z=NIDSNPYDTDK;; $m/Z=IEVGLVVGNSQVAFEK;; $m/Z=QSIINPDWNFEK;; $m/Z=EFSDIFR;; $m/Z=VFPPEIVEQMoxGCK;; $m/Z=GILLYGPPGCGK;; $m/Z=VVNGPEILNK;; $m/Z=YVGESEANIR;; $m/Z=KLFADAEEEQR;; $m/Z=LFADAEEEQR;; $m/Z=LFADAEEEQRR;; $m/Z=MoxEIGLPDEK;; $m/Z=LQILHIHTAR;; $m/Z=GHQLLSADVDIK;; $m/Z=NFSGAELEGLVR;; $m/Z=AESLQVTR;; $m/Z=WGDPVTR;; $m/Z=VLDDGELLVQQTK;; $m/Z=TPLVSVLLEGPPHSGK;; $m/Z=KIFDDAYK;; $m/Z=IFDDAYK;; $m/Z=GSMoxAGSTGVHDTVVNQLLSK;; $m/Z=SQLSCVVVDDIER;; $m/Z=LLIIGTTSRK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 812.4941 (0), 830.4426 (0), 871.4492 (0), 894.5487 (0),
  903.5261 (0), 913.4794 (0), 999.5371 (0), 1047.5475 (0),
  1082.6311 (0), 1101.7449 (0), 1137.6046 (0), 1142.7065 (0),
  1201.7686 (0), 1207.6097 (0), 1231.6869 (0), 1281.6121 (0),
  1291.7191 (0), 1295.7247 (0), 1319.6792 (0), 1335.6903 (0),
  1363.713 (0), 1457.8293 (0), 1490.7747 (0), 1519.8041 (0),
  1549.7817 (0), 1630.9634 (0), 1688.9673 (0), 2017.0582 (0)
  }
[Click to access protein entry]
 Spot: 250 (ob21dsub)
 pI: 6.04 Mw: 60000
 %vol: 0.285879   %od: 0.245088
 ================
 *DPYL2_RAT*
  accession n°: P47942

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VFNLYPR;; $m/Z=ISVGSDADLVIWDPDSVK;; $m/Z=THNSALEYNIFEGMoxECR;; $m/Z=IVLEDGTLHVTEGSGR;; $m/Z=NLHQSGFSLSGAQIDDNIPR;; $m/Z=MoxDENQFVAVTSTNAAK;; $m/Z=DNFTLIPEGTNGTEER;; $m/Z=SAAEVIAQAR;; $m/Z=SITIANQTNCPLYVTK;; $m/Z=ILDLGITGPEGHVLSRPEEVEAEAVNR;; $m/Z=DIGAIAQVHAENGDIIAEEQQR;; $m/Z=FQLTDSQIYEVLSVIR;; $m/Z=DRFQLTDSQIYEVLSVIR;; $m/Z=DHGVNSFLVYMoxAFK;; $m/Z=FQMoxPDQGMoxTSADDFFQGTK;; $m/Z=MoxVIPGGIDVHTR;; $m/Z=QIGENLIVPGGVK;; $m/Z=IVNDDQSFYADIYMoxEDGLIK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 908.5197 (0), 1015.5821 (0), 1310.7085 (0),
  1323.761 (0), 1643.8145 (0), 1682.8989 (0), 1741.8414 (0),
  1792.8842 (0), 1822.95 (0), 1911.0532 (0), 1916.0166 (0),
  2086.9272 (0), 2169.1035 (0), 2182.1765 (0), 2182.9375 (0),
  2365.123 (0), 2377.2029 (0), 2900.5396 (0)
  }
[Click to access protein entry]
 Spot: 416 (ob21dsub)
 pI: 6.49 Mw: 46000
 %vol: 0.557974   %od: 0.241749
 ================
 *GLNA_RAT*
  accession n°: P09606

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TCcamLLNETGDEPFQYKN;; $m/Z=RPSANCcamDPYAVTEAIVR;; $m/Z=IQLMoxYIWVDGTGEGLR;; $m/Z=LVFCcamEVFK;; $m/Z=MGDHLWVAR;; $m/Z=MoxGDHLWVAR;; $m/Z=TCcamLLNETGDEPFQYK;; $m/Z=IQLMYIWVDGTGEGLR;; $m/Z=HQYHIR;; $m/Z=KPAETNLR;; $m/Z=DIVEAHYR;; $m/Z=RHQYHIR;; $m/Z=ITGTNAEVMoxPAQWEFQIGPCcamEGIR;; $m/Z=ITGTNAEVMPAQWEFQIGPCcamEGIR;; $m/Z=RLTGFHETSNINDFSAGVANR;; $m/Z=LTGFHETSNINDFSAGVANR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 853.4418 (0), 928.519 (0), 1002.5082 (0),
  1009.5402 (0), 1041.5496 (0), 1084.5413 (0), 1100.5386 (0),
  1814.8528 (0), 1850.9692 (0), 1866.9612 (0), 1918.9661 (0),
  1928.9089 (0), 2150.0425 (0), 2306.1396 (0), 2704.3069 (0),
  2720.3188 (0) }
[Click to access protein entry]
 Spot: 218 (ob21dsub)
 pI: 7.22 Mw: 67000
 %vol: 0.181685   %od: 0.211879
 ================
 *TKT_RAT*
  accession n°: P50137

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FIECYIAEQNMoxVSIAVGCATR;; $m/Z=SVPMoxSTVFYPSDGVATEK;; $m/Z=TSRPENAIIYSNNEDFQVGQAK;; $m/Z=VLDPFTIKPLDK;; $m/Z=LILDCAR;; $m/Z=ILTVEDHYYEGGIGEAVSAVVVGEPGVTVTR;; $m/Z=LAVSQVPR;; $m/Z=MoxFGIDKDAIVQAVK;; $m/Z=LDNLVAIFDINR;; $m/Z=LGQSDPAPLQHQVDVYQK;; $m/Z=ILATPPQEDAPSVDIANIR;; $m/Z=IIALDGDTKNSTFSELFK;; $m/Z=NSTFSELFK;; $m/Z=TVPFCSTFAAFFTR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 860.4752 (0), 869.5297 (0), 1072.5436 (0),
  1385.804 (0), 1402.7815 (0), 1550.8208 (0), 1651.8051 (0),
  1930.9109 (0), 1999.0593 (0), 2020.0742 (0), 2023.0527 (0),
  2448.1335 (0), 2481.1951 (0), 3216.6145 (0)
  }
[Click to access protein entry]
 Spot: 221 (ob21dsub)
 pI: 5.84 Mw: 67000
 %vol: 0.25651   %od: 0.239237
 ================
 *ALBU_RAT*
  accession n°: P02770

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FKDLGEQHFK;; $m/Z=DVFLGTFLYEYSR;; $m/Z=RHPDYSVSLLLR;; $m/Z=HPDYSVSLLLR;; $m/Z=LGEYGFQNAVLVR;; $m/Z=CCTLPEAQR;; $m/Z=LPCVEDYLSAILNR;; $m/Z=CCSGSLVER;; $m/Z=RPCFSALTVDETYVPK;; $m/Z=AETFTFHSDICTLPDK;; $m/Z=AETFTFHSDICTLPDKEK;; $m/Z=AADKDNCFATEGPNLVAR;; $m/Z=LVQEVTDFAK;; $m/Z=SIHTLFGDK;; $m/Z=LRDNYGELADCCAK;; $m/Z=QEPERNECFLQHK;; $m/Z=NECFLQHK;; $m/Z=RHPYFYAPELLYYAEK;; $m/Z=HPYFYAPELLYYAEK;; $m/Z=YNEVLTQCCTESDK;; $m/Z=FPNAEFAEITK;; $m/Z=ECCHGDLLECADDR;; $m/Z=ECCHGDLLECADDRAELAK;; $m/Z=LQACCDKPVLQK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1017.5566 (0), 1067.5033 (0), 1075.5142 (0),
  1134.5343 (0), 1149.6262 (0), 1248.6649 (0), 1266.658 (0),
  1299.7382 (0), 1455.8364 (0), 1459.7808 (0), 1465.8137 (0),
  1609.8296 (0), 1662.8872 (0), 1684.7804 (0), 1714.8298 (0),
  1746.7544 (0), 1749.715 (0), 1881.9194 (0), 1882.9686 (0),
  1903.9451 (0), 1948.9453 (0), 2060.0605 (0), 2139.0234 (0),
  2261.9836 (0) }
[Click to access protein entry]
 Spot: 636 (ob21dsub)
 pI: 6.03 Mw: 26000
 %vol: 0.0452323   %od: 0.0765151
 ================
 *PSB3_RAT*
  accession n°: P40112

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FGIQAQMoxVTTDFQK;; $m/Z=RFGIQAQMoxVTTDFQK;; $m/Z=RFGPYYTEPVIAGLDPK;; $m/Z=FGPYYTEPVIAGLDPK;; $m/Z=DAVSGMoxGVIVHIIEK;; $m/Z=NCVAIAADR;; $m/Z=NCVAIAADRR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 989.5241 (0), 1145.6212 (0), 1583.874 (0),
  1629.8292 (0), 1766.9326 (0), 1785.9308 (0), 1923.0413 (0)
  }
[Click to access protein entry]
 Spot: 226 (ob21dsub)
 pI: 5.98 Mw: 68000
 %vol: 0.0318521   %od: 0.140767
 ================
 *DHSA_RAT*
  accession n°: Q920L2

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=KPFAEHWR;; $m/Z=VTLDYRPVIDK;; $m/Z=TLNEADCATVPPAIR;; $m/Z=TGHSLLHTLYGR;; $m/Z=GVIALCIEDGSIHR;; $m/Z=AKNTIIATGGYGR;; $m/Z=NTIIATGGYGR;; $m/Z=GEGGILINSQGER;; $m/Z=DHVYLQLHHLPPEQLATR;; $m/Z=HVNGQDQIVPGLYACGEAACASVHGANR;; $m/Z=LGANSLLDLVVFGR;; $m/Z=ACALSIAESCRPGDK;; $m/Z=ANAGEESVMoxNLDKLR;; $m/Z=SMQSHAAVFR;; $m/Z=VRIDEYDYSKPIEGQQK;; $m/Z=WHFYDTVK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1070.5187 (0), 1095.4757 (0), 1122.5519 (0),
  1149.5099 (0), 1318.6761 (0), 1321.6582 (0), 1329.6277 (0),
  1354.6719 (0), 1473.7815 (0), 1539.7314 (0), 1627.7401 (0),
  1634.7017 (0), 1662.778 (0), 2067.9402 (0), 2167.0396 (0),
  2951.2197 (0) }
[Click to access protein entry]
 Spot: 518 (ob21dsub)
 pI: 7.33 Mw: 38000
 %vol: 0.18987   %od: 0.196815
 ================
 *ROA2_RAT*
  accession n°: A7VJC3

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LFVGGIKEDTEEHHLR;; $m/Z=RGFGFVTFDDHDPVDK;; $m/Z=GFGFVTFDDHDPVDK;; $m/Z=GGNFGFGDSR;; $m/Z=LFIGGLSFETTEESLR;; $m/Z=IDTIEIITDR;; $m/Z=NYYEQWGK;; $m/Z=DYFEEYGKIDTIEIITDR;; $m/Z=NMoxGGPYGGGNYGPGGSGGSGGYGGR;; $m/Z=KLFIGGLSFETTEESLR;; $m/Z=GGGGNFGPGPGSNFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1013.4623 (0), 1087.5017 (0), 1188.6633 (0),
  1377.6483 (0), 1695.7739 (0), 1798.9413 (0), 1851.8871 (0),
  1879.9843 (0), 1927.0378 (0), 2205.9236 (0), 2220.0957 (0)
  }
[Click to access protein entry]
 Spot: 460 (ob21dsub)
 pI: 5.93 Mw: 42000
 %vol: 0.0438898   %od: 0.143186
 ================
 *GNAQ_RAT*
  accession n°: P82471

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VADPSYLPTQQDVLR;; $m/Z=VPTTGIIEYPFDLQSVIFR;; $m/Z=TIITYPWFQNSSVILFLNK;; $m/Z=VRVPTTGIIEYPFDLQSVIFR;; $m/Z=IMoxYSHLVDYFPEYDGPQR,277294;; $m/Z=YYLNDLDR;; $m/Z=VSAFENPYVDAIK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1071.5249 (0), 1452.7448 (0), 1701.8877 (0),
  2195.1689 (0), 2246.0049 (0), 2284.2129 (0), 2450.3135 (0)
  }
[Click to access protein entry]
 Spot: 604 (ob21dsub)
 pI: 5.55 Mw: 29000
 %vol: 0.0704796   %od: 0.0772465
 ================
 *CLIC4_RAT*
  accession n°: Q9Z0W7

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AGSDGESIGNCPFSQR;; $m/Z=GVVFSVTTVDLKR;; $m/Z=IEEFLEEVLCPPK;; $m/Z=HPESNTAGMoxDIFAK;; $m/Z=NSRPEANEALER;; $m/Z=YLTNAYSR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 987.5284 (0), 1385.7124 (0), 1420.8519 (0),
  1533.7285 (0), 1602.8651 (0), 1681.7648 (0)
  }
[Click to access protein entry]
 Spot: 335 (ob21dsub)
 pI: 5.59 Mw: 51000
 %vol: 0.263839   %od: 0.190727
 ================
 *VATB2_RAT*
  accession n°: P62815

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TVYETLDIGWQLLR;; $m/Z=RIPQSTLSEFYPR;; $m/Z=IPQSTLSEFYPR;; $m/Z=DVVDYSEENFAIVFAAMoxGVNMoxETAR;; $m/Z=TVSGVNGPLVILDHVK;; $m/Z=YAEIVHLTLPDGTK;; $m/Z=AVVQVFEGTSGIDAK;; $m/Z=TSCEFTGDILR;; $m/Z=GPVVLAEDFLDIMGQPINPQCR;; $m/Z=GPVVLAEDFLDIMoxGQPINPQCR;; $m/Z=IYPEEMIQTGISAIDGMNSIAR;; $m/Z=IYPEEMoxIQTGISAIDGMNSIAR;; $m/Z=IYPEEMoxIQTGISAIDGMoxNSIAR;; $m/Z=IPIFSAAGLPHNEIAAQICR;; $m/Z=SKDVVDYSEENFAIVFAAMoxGVNMoxETAR;; $m/Z=SDFEENGSMoxDNVCLFLNLANDPTIER;; $m/Z=HVLVILTDMSSYAEALR;; $m/Z=HVLVILTDMoxSSYAEALR;; $m/Z=GFPGYMYTDLATIYER;; $m/Z=GFPGYMoxYTDLATIYER;; $m/Z=QIYPPINVLPSLSR;; $m/Z=AVVGEEALTSDDLLYLEFLQK;; $m/Z=NFITQGPYENR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1298.6246 (0), 1338.6628 (0), 1437.7555 (0),
  1520.8021 (0), 1556.8433 (0), 1593.8535 (0), 1596.9241 (0),
  1647.9269 (0), 1706.9232 (0), 1896.9001 (0), 1912.8861 (0),
  1917.9659 (0), 1934.0038 (0), 2178.1523 (0), 2353.2092 (0),
  2409.2002 (0), 2425.2153 (0), 2441.165 (0), 2469.2246 (0),
  2485.2083 (0), 2810.2673 (0), 3016.3105 (0), 3025.3616 (0)
  }
[Click to access protein entry]
 Spot: 673 (ob21dsub)
 pI: 4.99 Mw: 23000
 %vol: 0.114547   %od: 0.109582
 ================
 *TCTP_RAT*
  accession n°: P63029

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GKLEEQKPER;; $m/Z=VKPFMoxTGAAEQIK;; $m/Z=EDGVTPFMoxIFFK;; $m/Z=DLISHDELFSDIYK;; $m/Z=LEEQKPER;; $m/Z=IREIADGLCLEVEGK;; $m/Z=EIADGLCLEVEGK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1028.5844 (0), 1213.7101 (0), 1432.7374 (0),
  1435.801 (0), 1446.7329 (0), 1694.8717 (0), 1701.9441 (0)
  }
[Click to access protein entry]
 Spot: 786 (ob21dsub)
 pI: 6.35 Mw: 94000
 %vol: 0.0351431   %od: 0.200861
 ================
 *PYGB_RAT*
  accession n°: P53534

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MSVIEEGDCKR;; $m/Z=HLDHVAALFPGDVDR;; $m/Z=HLEIIYAINQR;; $m/Z=VDWDKAWEITK;; $m/Z=VLYPNDNFFEGK;; $m/Z=ARPEYMoxLPVHFYGR;; $m/Z=IVNGWQVEEADDWLR;; $m/Z=DYFFALAHTVR;; $m/Z=TITEYAR;; $m/Z=DVVNMoxLMoxYHDRFK;; $m/Z=VIFLENYR;; $m/Z=LVTSIGDVVNHDPVVGDR;; $m/Z=QLLNCLHIITLYNR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 853.412 (0), 1053.5466 (0), 1323.6466 (0),
  1339.6572 (0), 1369.7358 (0), 1390.7206 (0), 1442.6714 (0),
  1661.8184 (0), 1699.814 (0), 1751.8499 (0), 1770.9413 (0),
  1829.8752 (0), 1891.9629 (0) }
[Click to access protein entry]
 Spot: 215 (ob21dsub)
 pI: 5.36 Mw: 67000
 %vol: 1.07568   %od: 0.275913
 ================
 *HSP7C_RAT*
  accession n°: P63018

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=QTQTFTTYSDNQPGVLIQVYEGER;; $m/Z=TLSSSTQASIEIDSLYEGIDFYTSITR;; $m/Z=STAGDTHLGGEDFDNR;; $m/Z=DAGTIAGLNVLR;; $m/Z=SQIHDIVLVGGSTR;; $m/Z=ARFEELNADLFR;; $m/Z=CcamNEIISWLDK;; $m/Z=FEELNADLFR;; $m/Z=MoxVNHFIAEFK;; $m/Z=MVNHFIAEFK;; $m/Z=VEIIANDQGNR;; $m/Z=LLQDFFNGK;; $m/Z=FELTGIPPAPR;; $m/Z=HWPFMoxVVNDAGRPK;; $m/Z=HWPFMVVNDAGRPK;; $m/Z=TTPSYVAFTDTER;; $m/Z=NQTAEKEEFEHQQK;; $m/Z=TVTNAVVTVPAYFNDSQR;; $m/Z=GPAVGIDLGTTYSCcamVGVFQHGK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1081.5497 (0), 1197.6462 (0), 1199.6581 (0),
  1228.624 (0), 1235.6062 (0), 1251.601 (0), 1253.5995 (0),
  1277.6543 (0), 1480.7423 (0), 1481.7642 (0), 1487.687 (0),
  1653.8215 (0), 1669.8108 (0), 1691.7145 (0), 1745.7936 (0),
  1981.9838 (0), 2263.1096 (0), 2774.2866 (0), 2997.4319 (0)
  }
[Click to access protein entry]
 Spot: 509 (ob21dsub)
 pI: 5.95 Mw: 39000
 %vol: 0.0731222   %od: 0.12572
 ================
 *LDHB_RAT*
  accession n°: P42123

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MoxVVDSAYEVIK;; $m/Z=IHPVSTMVK,270-278IHPVSTMoxVK;; $m/Z=FIIPQIVK;; $m/Z=SADTLWDIQK;; $m/Z=LKDDEVAQLR;; $m/Z=VIGSGCcamNLDSAR;; $m/Z=MVVDSAYEVIK;; $m/Z=IVVVTAGVR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 913.5573 (0), 957.579 (0), 1011.521 (0), 1027.5233 (0),
  1176.5425 (0), 1186.599 (0), 1248.5537 (0), 1253.5847 (0),
  1269.583 (0) }
[Click to access protein entry]
 Spot: 567 (ob21dsub)
 pI: 8.31 Mw: 34000
 %vol: 0.0332895   %od: 0.0802017
 ================
 *NQO1_RAT*
  accession n°: P05982

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ALIVLAHAER;; $m/Z=RALIVLAHAER;; $m/Z=FGLSVGHHLGK;; $m/Z=FCGFQVLEPQLVYSIGHTPPDAR;; $m/Z=VLVAGFAYTYATMoxYDK;; $m/Z=LSPDIVAEQK;; $m/Z=DSENFQYPVESSLAYK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1092.7021 (0), 1099.6372 (0), 1151.6727 (0),
  1248.7651 (0), 1828.9611 (0), 1876.9017 (0), 2631.3379 (0)
  }
[Click to access protein entry]
 Spot: 561 (ob21dsub)
 pI: 6.32 Mw: 34000
 %vol: 0.0520115   %od: 0.0954374
 ================
 *ESTD_RAT*
  accession n°: B0BNE5

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SGCQQAASEHGLVVIAPDTSPR;; $m/Z=SYSGPQIDILIDQGK;; $m/Z=KIPVVFR;; $m/Z=LQEGYDHSYYFIATFITDHIR;; $m/Z=MoxYSYVTEELPQLINANFPVDPQR;; $m/Z=MYSYVTEELPQLINANFPVDPQR;; $m/Z=ISIFGHSMoxGGHGALICALK;; $m/Z=VFEHSSVELK;; $m/Z=KAFNGYLGPDQSK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 858.5389 (0), 1174.582 (0), 1424.6692 (0),
  1633.7722 (0), 1984.9352 (0), 2280.0288 (0), 2589.1438 (0),
  2724.228 (0), 2740.2061 (0) }
[Click to access protein entry]
 Spot: 745 (ob21dsub)
 pI: 8.22 Mw: 18000
 %vol: 0.398608   %od: 0.244581
 ================
 *COF1_RAT*
  accession n°: P45592

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YALYDATYETK;; $m/Z=AVLFCLSEDK;; $m/Z=AVLFCLSEDKK;; $m/Z=NIILEEGK;; $m/Z=NIILEEGKEILVGDVGQTVDDPYTTFVK;; $m/Z=EILVGDVGQTVDDPYTTFVK;; $m/Z=MLPDKDCR;; $m/Z=MoxLPDKDCR;; $m/Z=KEDLVFIFWAPESAPLK;; $m/Z=HELQANCYEEVK;; $m/Z=HELQANCYEEVKDR;; $m/Z=LGGSAVISLEGKPL }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 915.5233 (0), 1034.5144 (0), 1050.4915 (0),
  1181.6146 (0), 1309.6951 (0), 1337.6335 (0), 1340.7212 (0),
  1519.6941 (0), 1790.8291 (0), 1990.0724 (0), 2196.0989 (0),
  3092.5837 (0) }
[Click to access protein entry]
 Spot: 698 (ob21dsub)
 pI: 5.78 Mw: 20000
 %vol: 0.0528608   %od: 0.0553631
 ================
 *RAB2A_RAT*
  accession n°: P05712

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LQIWDTAGQESFR;; $m/Z=SCLLLQFTDKR;; $m/Z=YIIIGDTGVGK;; $m/Z=TASNVEEAFINTAK;; $m/Z=KEEGEAFAR;; $m/Z=DTFNHLTTWLEDAR;; $m/Z=GAAGALLVYDITRR;; $m/Z=GAAGALLVYDITR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1036.4835 (0), 1135.6008 (0), 1319.7065 (0),
  1380.6974 (0), 1475.781 (0), 1494.7217 (0), 1550.7377 (0),
  1718.816 (0) }
[Click to access protein entry]
 Spot: 697 (ob21dsub)
 pI: 7.44 Mw: 20000
 %vol: 0.0929271   %od: 0.120282
 ================
 *SODM_RAT*
  accession n°: P07895

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AIWNVINWENVSQR;; $m/Z=HHATYVNNLNVTEEK;; $m/Z=GDVTTQVALQPALK;; $m/Z=GELLEAIKR;; $m/Z=RDFGSFEK;; $m/Z=DFGSFEK;; $m/Z=NVRPDYLK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 829.3613 (0), 985.4772 (0), 1004.5492 (0),
  1028.6023 (0), 1440.7465 (0), 1728.8425 (0), 1768.7987 (0)
  }
[Click to access protein entry]
 Spot: 765 (ob21dsub)
 pI: 6.91 Mw: 18000
 %vol: 0.136453   %od: 0.127826
 ================
 *NDKB_RAT*
  accession n°: P19804

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TFIAIKPDGVQR;; $m/Z=GLVGEIIKR;; $m/Z=FLRASEEHLK;; $m/Z=QHYIDLK;; $m/Z=DRPFFPGLVK;; $m/Z=YMoxNSGPVVAMVWEGLNVVK;; $m/Z=YMoxNSGPVVAMoxVWEGLNVVK;; $m/Z=VMLGETNPADSKPGTIR;; $m/Z=VMoxLGETNPADSKPGTIR;; $m/Z=NIIHGSDSVESAEK;; $m/Z=EIGLWFKPEELIDYK;; $m/Z=SCAHDWVYE }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 916.5161 (0), 984.6538 (0), 1166.4937 (0),
  1175.6959 (0), 1229.6199 (0), 1344.8036 (0), 1485.7596 (0),
  1785.9635 (0), 1801.9429 (0), 1880.0118 (0), 2109.0732 (0),
  2125.0679 (0) }
[Click to access protein entry]
 Spot: 304 (ob21dsub)
 pI: 5.94 Mw: 54000
 %vol: 0.0720217   %od: 0.135423
 ================
 *COR1A_RAT*
  accession n°: Q91ZN1

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NLNAIVQK;; $m/Z=ATPEPSSTLSSDTVSR;; $m/Z=ILTTGFSR;; $m/Z=ERPHEGTRPVHAVFVSEGK;; $m/Z=DGALICTSCR;; $m/Z=QVALWDTK;; $m/Z=VSQTTWDSGFCAVNPK;; $m/Z=ADQCYEDVR;; $m/Z=HVFGQPAK;; $m/Z=FRHVFGQPAK;; $m/Z=CEPIAMTVPRK;; $m/Z=CEPIAMoxTVPRK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 883.4368 (0), 894.4651 (0), 899.4989 (0), 960.4724 (0),
  1152.4895 (0), 1155.4485 (0), 1186.6166 (0), 1301.6759 (0),
  1317.6367 (0), 1634.766 (0), 1796.8097 (0), 2132.0872 (0)
  }
[Click to access protein entry]
 Spot: 498 (ob21dsub)
 pI: 7.13 Mw: 40000
 %vol: 0.243082   %od: 0.216162
 ================
 *G3P_RAT*
  accession n°: P04797

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VIISAPSADAPMFVMGVNHEK;; $m/Z=LTGMoxAFR;; $m/Z=VPTPNVSVVDLTCcamR;; $m/Z=LVINGKPITIFQER;; $m/Z=LISWYDNEYGYSNR;; $m/Z=VIISAPSADAPMoxFVMGVNHEK;; $m/Z=VIHDNFGIVEGLMTTVHAITATQK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 811.3965 (0), 1556.746 (0), 1627.8828 (0),
  1779.7303 (0), 2213.0085 (0), 2229.0061 (0), 2595.2351 (0)
  }
[Click to access protein entry]
 Spot: 649 (ob21dsub)
 pI: 5.36 Mw: 25000
 %vol: 0.309711   %od: 0.263597
 ================
 *UCHL1_RAT*
  accession n°: Q00981

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VDDKVNFHFILFNNVDGHLYELDGR;; $m/Z=VNFHFILFNNVDGHLYELDGR;; $m/Z=MoxPFPVNHGASSEDSLLQDAAK;; $m/Z=MPFPVNHGASSEDSLLQDAAK;; $m/Z=NEAIQAAHDSVAQEGQCcamR;; $m/Z=LGVAGQWR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 886.4772 (0), 1983.9021 (0), 2214.0791 (0),
  2230.052 (0), 2519.2493 (0), 2976.4614 (0)
  }
[Click to access protein entry]
 Spot: 313 (ob21dsub)
 pI: 6.92 Mw: 54000
 %vol: 0.129126   %od: 0.219076
 ================
 *G6PI_RAT*
  accession n°: Q6P6V0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=EWFLQAAK;; $m/Z=LRELFEADPER;; $m/Z=ELFEADPER;; $m/Z=FNHFSLNLNTNHGHILLDYSK;; $m/Z=VWFVSNIDGTHIAK;; $m/Z=TLANLNPESSLFIIASK;; $m/Z=TFTTQETITNAETAK;; $m/Z=NMoxFEFWDWVGGR;; $m/Z=MoxIPCDFLIPVQTQHPIR;; $m/Z=ILLANFLAQTEALMoxK;; $m/Z=VFEGNRPTNSIVFTK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 992.5527 (0), 1105.5643 (0), 1374.746 (0),
  1559.7184 (0), 1586.861 (0), 1655.8442 (0), 1691.9551 (0),
  1708.9366 (0), 1818.0222 (0), 2081.0994 (0), 2484.2729 (0)
  }
[Click to access protein entry]
 Spot: 267 (ob21dsub)
 pI: 5.40 Mw: 59000
 %vol: 0.23457   %od: 0.220173
 ================
 *AINX_RAT*
  accession n°: P23565

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ALEAELAALRQR;; $m/Z=SNVASTAACSSASSLGLGLAYR;; $m/Z=RLPASDGLDLSQAAAR;; $m/Z=LPASDGLDLSQAAAR;; $m/Z=TNEKEQLQGLNDR;; $m/Z=FAVFIEK;; $m/Z=VESLLDELAFVR;; $m/Z=VHQLETQNR;; $m/Z=KVESLLDELAFVR;; $m/Z=DGLAEEVQR;; $m/Z=AQALLER;; $m/Z=VGELFQR;; $m/Z=FSTSGLSISGLNPLPNPSYLLPPR;; $m/Z=MoxALDIEIAAYR;; $m/Z=HSAEVAGYQDSIGQLESDLR;; $m/Z=QILELEER;; $m/Z=GANESLER;; $m/Z=TIEIEGLR;; $m/Z=EEIHEYRR;; $m/Z=FANLNEQAAR;; $m/Z=KEEEEEEEEEEGASK;; $m/Z=LLEGEETR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 800.4516 (0), 848.451 (0), 853.4637 (0), 875.4241 (0),
  930.518 (0), 946.4814 (0), 1016.4974 (0), 1029.5498 (0),
  1124.5687 (0), 1131.5419 (0), 1133.5576 (0), 1281.6282 (0),
  1340.7633 (0), 1390.6941 (0), 1484.7465 (0), 1518.8353 (0),
  1544.7429 (0), 1640.8353 (0), 1780.7581 (0), 2142.9946 (0),
  2174.9763 (0), 2527.2839 (0) }
[Click to access protein entry]
 Spot: 341 (ob21dsub)
 pI: 4.37 Mw: 51000
 %vol: 0.205541   %od: 0.169953
 ================
 *CALR_RAT*
  accession n°: P18418

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FVLSSGKFYGDQEK;; $m/Z=IKDPDAAKPEDWDER;; $m/Z=DMHGDSEYNIMFGPDICcamGPGTK;; $m/Z=IDNSQVESGSLEDDWDFLPPKK;; $m/Z=CcamKDDEFTHLYTLIVRPDNTYEVK;; $m/Z=KPEDWDEEMDGEWEPPVIQNPEYK;; $m/Z=SGTIFDNFLITNDEAYAEEFGNETWGVTK;; $m/Z=FYALSAR;; $m/Z=FEPFSNK;; $m/Z=GQTLVVQFTVK;; $m/Z=EQFLDGDAWTNR;; $m/Z=HEQNIDCcamGGGYVK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 827.4315 (0), 868.4095 (0), 1219.6877 (0),
  1451.6346 (0), 1476.6302 (0), 1604.8276 (0), 1784.8262 (0),
  2440.9998 (0), 2519.1848 (0), 2856.3904 (0), 2960.3196 (0),
  3268.4668 (0) }
[Click to access protein entry]
 Spot: 369 (ob21dsub)
 pI: 5.79 Mw: 50000
 %vol: 0.169286   %od: 0.181726
 ================
 *ENOA_RAT*
  accession n°: P04764

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HIADLAGNPEVILPVPAFNVINGGSHAGNK;; $m/Z=YNQILR;; $m/Z=FGANAILGVSLAVCcamK;; $m/Z=LAQSNGWGVMVSHR;; $m/Z=LAQSNGWGVMoxVSHR;; $m/Z=AAVPSGASTGIYEALELR;; $m/Z=LAMQEFMILPVGASSFR;; $m/Z=LAMoxQEFMILPVGASSFR;; $m/Z=LAMoxQEFMoxILPVGASSFR;; $m/Z=AGYTDQVVIGMDVAASEFYR;; $m/Z=AGYTDQVVIGMoxDVAASEFYR;; $m/Z=SGETEDTFIADLVVGLCTGQIK;; $m/Z=DYPVVSIEDPFDQDDWDAWQK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 806.4263 (0), 1519.8163 (0), 1541.7621 (0),
  1557.7607 (0), 1804.9261 (0), 1896.9664 (0), 1912.9618 (0),
  1928.9487 (0), 2192.0247 (0), 2208.0225 (0), 2353.1716 (0),
  2568.137 (0), 3021.6111 (0) }
[Click to access protein entry]
 Spot: 748 (ob21dsub)
 pI: 4.32 Mw: 18000
 %vol: 0.133049   %od: 0.117539
 ================
 *SYUB_RAT*
  accession n°: Q63754

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=EGVVAAAEK;; $m/Z=QGVTEAAEK;; $m/Z=EGVLYVGSK;; $m/Z=EGVVQGVASVAEK;; $m/Z=EGVVQGVASVAEKTK;; $m/Z=EQASHLGGAVFSGAGNIAAATGLVK;; $m/Z=TKEQASHLGGAVFSGAGNIAAATGLVK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 873.4904 (0), 932.4891 (0), 951.5428 (0),
  1272.7188 (0), 1501.8124 (0), 2326.2756 (0), 2555.4172 (0)
  }
[Click to access protein entry]
 Spot: 409 (ob21dsub)
 pI: 6.08 Mw: 46000
 %vol: 0.105445   %od: 0.174919
 ================
 *SAHH_RAT*
  accession n°: P10760

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ALDIAENEMPGLMR;; $m/Z=VADIGLAAWGR;; $m/Z=ALDIAENEMoxPGLMR;; $m/Z=HPQLLSGIR;; $m/Z=SKFDNLYGCR;; $m/Z=FDNLYGCR;; $m/Z=EGNIFVTTTGCVDIILGR;; $m/Z=VNIKPQVDR;; $m/Z=IILLAEGR;; $m/Z=YPVGVHFLPK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 884.5543 (0), 1020.5966 (0), 1044.462 (0),
  1068.6064 (0), 1128.6208 (0), 1156.6375 (0), 1259.5927 (0),
  1559.7665 (0), 1575.7516 (0), 1965.0134 (0)
  }
[Click to access protein entry]
 Spot: 286 (ob21dsub)
 pI: 6.89 Mw: 57000
 %vol: 0.186307   %od: 0.236854
 ================
 *KPYM_RAT*
  accession n°: P11980

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=RFDEILEASDGIMVAR;; $m/Z=FGVEQDVDMoxVFASFIR;; $m/Z=LNFSHGTHEYHAETIK;; $m/Z=FDEILEASDGIMVAR;; $m/Z=APIIAVTR;; $m/Z=MQHLIAR;; $m/Z=NTGIICcamTIGPASR;; $m/Z=IYVDDGLISLQVK;; $m/Z=CcamDENILWLDYK;; $m/Z=CcamLAAALIVLTESGR;; $m/Z=DAVLDAWAEDVDLR;; $m/Z=LDIDSAPITAR;; $m/Z=GDVVIVLTGWRPGSGFTNTMoxR;; $m/Z=KGDVVIVLTGWRPGSGFTNTMoxR;; $m/Z=AATESFASDPILYRPVAVALDTK;; $m/Z=MoxQHLIAR;; $m/Z=IENHEGVR;; $m/Z=LLFEELAR;; $m/Z=GDYPLEAVR;; $m/Z=EAEAAVFHR;; $m/Z=FGVEQDVDMVFASFIR;; $m/Z=RFDEILEASDGIMoxVAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 840.5248 (0), 868.4826 (0), 884.4578 (0), 953.478 (0),
  990.5673 (0), 1019.5292 (0), 1029.5168 (0), 1171.6344 (0),
  1359.7218 (0), 1462.803 (0), 1468.6533 (0), 1473.7977 (0),
  1587.7517 (0), 1665.7949 (0), 1821.9128 (0), 1837.8943 (0),
  1859.8916 (0), 1875.8804 (0), 1883.886 (0), 2279.1167 (0),
  2407.282 (0), 2435.2668 (0) }
[Click to access protein entry]
 Spot: 264 (ob21dsub)
 pI: 5.13 Mw: 58000
 %vol: 0.358289   %od: 0.211325
 ================
 *GDIA_RAT*
  accession n°: P50398

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TDDYLDQPCLETINR;; $m/Z=LYSESLAR;; $m/Z=SPYLYPLYGLGELPQGFAR;; $m/Z=NTNDANSCQIIIPQNQVNR;; $m/Z=YIAIASTTVETAEPEK;; $m/Z=MoxAGSAFDFENMoxKR;; $m/Z=MoxLLYTEVTR;; $m/Z=MLLYTEVTR;; $m/Z=GRDWNVDLIPK;; $m/Z=FQLLEGPPESMoxGR;; $m/Z=RFQLLEGPPESMoxGR;; $m/Z=NPYYGGESSSITPLEELYKR;; $m/Z=NPYYGGESSSITPLEELYK;; $m/Z=VVEGSFVYK;; $m/Z=VPSTETEALASNLMoxGMoxFEK;; $m/Z=FLVFVANFDENDPK;; $m/Z=TFEGVDPQTTSMoxR;; $m/Z=KFDLGQDVIDFTGHALALYR;; $m/Z=FDLGQDVIDFTGHALALYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 938.4754 (0), 1027.5195 (0), 1125.5604 (0),
  1141.5543 (0), 1312.6606 (0), 1476.6689 (0), 1484.6222 (0),
  1535.6089 (0), 1632.7625 (0), 1654.7584 (0), 1722.843 (0),
  1852.7759 (0), 2086.9099 (0), 2141.0359 (0), 2146.9617 (0),
  2151.01 (0), 2198.9685 (0), 2279.095 (0), 2303.033 (0)
  }
[Click to access protein entry]
 Spot: 195 (ob21dsub)
 pI: 5.26 Mw: 76000
 %vol: 0.0444205   %od: 0.137901
 ================
 *DPP3_RAT*
  accession n°: O55096

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SVGKPALER;; $m/Z=ALYEGYAAVTDAPPECFLTLR;; $m/Z=KLIVQPNTR;; $m/Z=LIVQPNTR;; $m/Z=LEGSEVQLVEYEASAAGLIR;; $m/Z=AGLLALEFYTPETANWR;; $m/Z=LLSPTER;; $m/Z=LFRAQDPDQLR;; $m/Z=AQDPDQLR;; $m/Z=YHYEVR;; $m/Z=SYEFQGNHFQVTR;; $m/Z=GPIVESYIGFIESYR;; $m/Z=GPIVESYIGFIESYRDPFGSR;; $m/Z=GEFEGFVAMoxVNK;; $m/Z=LVASAEQLLKELPWPPAFEK;; $m/Z=NVSLGNVLAVAYATK;; $m/Z=LTFMoxEEEDKDLYIR;; $m/Z=WKGPSFDVQVGLHELLGHGSGK;; $m/Z=GPSFDVQVGLHELLGHGSGK;; $m/Z=GAFNFDQETVINPETGEQIQSWYR;; $m/Z=FSTIASSYEECR;; $m/Z=QAHMQAR;; $m/Z=VLLEAGEGLVTVTPTTGSDGRPDAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 815.4948 (0), 841.4131 (0), 866.4433 (0), 940.5836 (0),
  942.5077 (0), 956.5837 (0), 1068.6882 (0), 1343.6807 (0),
  1358.7074 (0), 1449.6936 (0), 1519.8574 (0), 1612.802 (0),
  1729.9287 (0), 1817.9069 (0), 1952.0405 (0), 2034.0823 (0),
  2134.1528 (0), 2266.196 (0), 2348.2673 (0), 2357.2007 (0),
  2389.2307 (0), 2511.3557 (0), 2829.3635 (0)
  }
[Click to access protein entry]
 Spot: 138 (ob21dsub)
 pI: 6.26 Mw: 93000
 %vol: 0.043092   %od: 0.183225
 ================
 *PYGB_RAT*
  accession n°: P53534

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TCAYTNHTVLPEALER;; $m/Z=HLEIIYAINQR;; $m/Z=HLDHVAALFPGDVDR;; $m/Z=IGEGFLTDLSQLK;; $m/Z=LLSLVDDEAFIR;; $m/Z=QLLNCLHIITLYNR;; $m/Z=LVTSIGDVVNHDPVVGDR;; $m/Z=VIFLENYR;; $m/Z=QAVDQISSGFFSPK;; $m/Z=DVVNMoxLMoxYHDRFK;; $m/Z=VFADYEAYIQCQAQVDHLYR;; $m/Z=TITEYAR;; $m/Z=VAIQLNDTHPALSIPELMoxR;; $m/Z=FGCRDPVR;; $m/Z=LKQEYFVVAATLQDIIR;; $m/Z=VLYPNDNFFEGK;; $m/Z=DFNVGDYIEAVLDR;; $m/Z=LKDFNVGDYIEAVLDR;; $m/Z=ARPEYMoxLPVHFYGR;; $m/Z=IVNGWQVEEADDWLR;; $m/Z=YEFGIFNQK;; $m/Z=TQQHYYERDPK;; $m/Z=TQQHYYER;; $m/Z=DYFFALAHTVR;; $m/Z=GIAGLGDVAEVR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 853.4267 (0), 1006.4757 (0), 1053.5664 (0),
  1124.5096 (0), 1145.5278 (0), 1156.6158 (0), 1339.6655 (0),
  1369.74 (0), 1390.7335 (0), 1420.7064 (0), 1442.6539 (0),
  1464.6711 (0), 1510.7065 (0), 1625.754 (0), 1661.8152 (0),
  1699.8086 (0), 1751.8234 (0), 1770.9324 (0), 1829.854 (0),
  1866.9269 (0), 1874.8871 (0), 1891.9445 (0), 2007.0974 (0),
  2134.0752 (0), 2489.1104 (0) }
[Click to access protein entry]
 Spot: 591 (ob21dsub)
 pI: 5.86 Mw: 30000
 %vol: 0.0357633   %od: 0.0521544
 ================
 *PSB7_RAT*
  accession n°: Q9JHW0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DGIVLGADTR;; $m/Z=MLKQMLFR;; $m/Z=YQGYIGAALVLGGVDVTGPHLYSIYPHGSTDK;; $m/Z=LPYVTMoxGSGSLAAMoxAVFEDK;; $m/Z=FRPDMoxEEEEAK;; $m/Z=FRPDMoxEEEEAKK;; $m/Z=LDFLRPYSVPNKK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1016.5797 (0), 1066.5514 (0), 1396.6536 (0),
  1524.7445 (0), 1576.9519 (0), 2119.0261 (0), 3348.679 (0)
  }
[Click to access protein entry]
 Spot: 560 (ob21dsub)
 pI: 5.87 Mw: 34000
 %vol: 0.0552747   %od: 0.140466
 ================
 *THTM_RAT*
  accession n°: P97532

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=THEDILENLDAR;; $m/Z=FQVVDAR;; $m/Z=SPEEIQR;; $m/Z=VWWMoxFR;; $m/Z=RFQVVDAR;; $m/Z=FQGTQPEPR;; $m/Z=LLDASWYLPK;; $m/Z=AQPEHVISQGR;; $m/Z=HIPGAAFFDIDR;; $m/Z=ALVSAQWVAEALK;; $m/Z=THEDILENLDARR;; $m/Z=DGIEPGHIPGSVNIPFTEFLTSEGLEK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 834.4592 (0), 858.4482 (0), 940.4637 (0), 990.5605 (0),
  1059.5449 (0), 1205.6615 (0), 1221.6569 (0), 1358.71 (0),
  1385.769 (0), 1425.7224 (0), 1581.8419 (0), 2883.4839 (0)
  }
[Click to access protein entry]
 Spot: 627 (ob21dsub)
 pI: 5.22 Mw: 27000
 %vol: 0.11136   %od: 0.162367
 ================
 *GDIR1_RAT*
  accession n°: Q5XI73

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SIQEIQELDKDDESLR;; $m/Z=YKEALLGR;; $m/Z=VAVSADPNVPNVIVTR;; $m/Z=LTLVCSTAPGPLELDLTGDLESFKK;; $m/Z=YIQHTYR;; $m/Z=TDYMoxVGSYGPR;; $m/Z=AEEYEFLTPMoxEEAPK;; $m/Z=FTDDDKTDHLSWEWNLTIK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 949.5557 (0), 980.5049 (0), 1261.5623 (0),
  1650.9283 (0), 1799.8082 (0), 1917.9563 (0), 2364.1216 (0),
  2704.4143 (0) }
[Click to access protein entry]
 Spot: 519 (ob21dsub)
 pI: 8.23 Mw: 38000
 %vol: 0.404831   %od: 0.239142
 ================
 *A7VJC4*
  accession n°: A7VJC2

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=IDTIEIITDR;; $m/Z=GGGGNFGPGPGSNFR;; $m/Z=YHTINGHNAEVR;; $m/Z=GFGFVTFDDHDPVDK;; $m/Z=LFIGGLSFETTEESLR;; $m/Z=RGFGFVTFDDHDPVDK;; $m/Z=LFVGGIKEDTEEHHLR;; $m/Z=KLFIGGLSFETTEESLR;; $m/Z=NMoxGGPYGGGNYGPGGSGGSGGYGGR;; $m/Z=DYFEEYGKIDTIEIITDR;; $m/Z=GGNFGFGDSR;; $m/Z=DYFEEYGK;; $m/Z=NYYEQWGK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1013.4568 (0), 1050.4509 (0), 1087.4933 (0),
  1188.6604 (0), 1377.6431 (0), 1410.7014 (0), 1695.7711 (0),
  1798.9358 (0), 1851.8817 (0), 1879.9746 (0), 1927.0298 (0),
  2205.9133 (0), 2220.083 (0) }
[Click to access protein entry]
 Spot: 373 (ob21dsub)
 pI: 4.78 Mw: 50000
 %vol: 0.108265   %od: 0.193087
 ================
 *ATPB_RAT*
  accession n°: P10719

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=IPSAVGYQPTLATDMoxGTMQER;; $m/Z=KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR;; $m/Z=GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR;; $m/Z=AIAELGIYPAVDPLDSTSR;; $m/Z=IMoxDPNIVGSEHYDVAR;; $m/Z=IMNVIGEPIDER;; $m/Z=FLSQPFQVAEVFTGHMoxGK;; $m/Z=IPVGPETLGR;; $m/Z=VLDSGAPIKIPVGPETLGR;; $m/Z=TIAMoxDGTEGLVR;; $m/Z=LVLEVAQHLGESTVR;; $m/Z=SLQDIIAILGMoxDELSEEDKLTVSR;; $m/Z=IMoxNVIGEPIDER;; $m/Z=AHGGYSVFAGVGER;; $m/Z=TREGNDLYHEMoxIESGVINLK;; $m/Z=EGNDLYHEMoxIESGVINLK;; $m/Z=VALVYGQMNEPPGAR;; $m/Z=DQEGQDVLLFIDNIFR;; $m/Z=FTQAGSEVSALLGR;; $m/Z=IPSAVGYQPTLATDMGTMQER }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1038.6235 (0), 1278.6752 (0), 1385.7509 (0),
  1401.7396 (0), 1406.7268 (0), 1435.7926 (0), 1601.8574 (0),
  1650.9573 (0), 1831.9027 (0), 1919.1407 (0), 1922.0114 (0),
  1988.0708 (0), 2039.0228 (0), 2077.0068 (0), 2266.137 (0),
  2282.1208 (0), 2334.1582 (0), 2691.3984 (0), 3714.8994 (0),
  3842.988 (0) }
[Click to access protein entry]
 Spot: 543 (ob21dsub)
 pI: 5.89 Mw: 31000
 %vol: 0.0420502   %od: 0.0912731
 ================
 *ANXA3_RAT*
  accession n°: P14669

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=WGTDEDKFTEILCLR;; $m/Z=LTFDEYR;; $m/Z=GELSGHFEDLLLAVVR;; $m/Z=NTPAFLAGR;; $m/Z=NTPAFLAGRLHQALK;; $m/Z=GAGTDEFTLNR;; $m/Z=SEIDLLDIR;; $m/Z=SEIDLLDIRR;; $m/Z=HYGCSLYSAIQSDTSGDYR;; $m/Z=WGTDEDK;; $m/Z=DAQTLYDAGEKK;; $m/Z=DAQTLYDAGEK;; $m/Z=ALLTLADGGRDESLK;; $m/Z=ALLTLADGGR;; $m/Z=DDISSETSGDFR;; $m/Z=NLRDDISSETSGDFR;; $m/Z=EISQAYYTAYK;; $m/Z=GMoxGTDEDTLIEILTTR;; $m/Z=GDLSGHFEHVMoxVALITAPAVFDAK;; $m/Z=TLINILTER;; $m/Z=GTINNYPGFNPSVDAEAIRK;; $m/Z=GTINNYPGFNPSVDAEAIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 850.3926 (0), 943.4409 (0), 946.499 (0), 986.546 (0),
  1072.6255 (0), 1073.6036 (0), 1180.5553 (0), 1210.5369 (0),
  1229.6597 (0), 1328.5701 (0), 1336.5959 (0), 1338.6057 (0),
  1558.8068 (0), 1636.9137 (0), 1711.7512 (0), 1754.9171 (0),
  1780.8038 (0), 1882.8707 (0), 2034.9592 (0), 2163.0439 (0),
  2179.8945 (0), 2541.188 (0) }
[Click to access protein entry]
 Spot: 455 (ob21dsub)
 pI: 6.98 Mw: 43000
 %vol: 0.0825146   %od: 0.137205
 ================
 *ALDOC_RAT*
  accession n°: P09117

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=CSLPRPWALTFSYGR;; $m/Z=ALQASALSAWR;; $m/Z=DNAGAATEEFIK;; $m/Z=DNAGAATEEFIKR;; $m/Z=YEGSGDGGAAAQSLYVANHAY;; $m/Z=LSQIGVENTEENRR;; $m/Z=QVLFSADDR;; $m/Z=QVLFSADDRVK;; $m/Z=CIGGVIFFHETLYQK;; $m/Z=DDNGVPFVR;; $m/Z=GVVPLAGTDGETTTQGLDGLLER;; $m/Z=TPSALAILENANVLAR;; $m/Z=YSPEEIAMATVTALR;; $m/Z=TVPPAVPGVTFLSGGQSEEEASLNLNAINR;; $m/Z=LSQIGVENTEENR;; $m/Z=ELSDIALR;; $m/Z=PHSYPALSAEQKK;; $m/Z=PHSYPALSAEQK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 916.4854 (0), 1018.4789 (0), 1050.5006 (0),
  1173.6208 (0), 1265.5754 (0), 1277.681 (0), 1327.6377 (0),
  1421.6825 (0), 1455.7528 (0), 1488.7065 (0), 1644.8049 (0),
  1651.8408 (0), 1652.9058 (0), 1810.8783 (0), 1811.8762 (0),
  2100.8772 (0), 2299.1304 (0), 3067.5046 (0)
  }
[Click to access protein entry]
 Spot: 183 (ob21dsub)
 pI: 6.33 Mw: 79000
 %vol: 0.0515045   %od: 0.170625
 ================
 *NSF_RAT*
  accession n°: Q9QUL6

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=IEVGLVVGNSQVAFEK;; $m/Z=YIFTLR;; $m/Z=QSIINPDWNFEK;; $m/Z=MoxGIGGLDKEFSDIFR;; $m/Z=EFSDIFR;; $m/Z=VFPPEIVEQMoxGCK;; $m/Z=GILLYGPPGCGK;; $m/Z=YVGESEANIR;; $m/Z=KLFADAEEEQR;; $m/Z=LFADAEEEQR;; $m/Z=LGANSGLHIIIFDEIDAICK;; $m/Z=IDGVEQLNNILVIGMTNRPDLIDEALLRPGR;; $m/Z=LQILHIHTAR;; $m/Z=GHQLLSADVDIK;; $m/Z=NFSGAELEGLVR;; $m/Z=AESLQVTR;; $m/Z=WGDPVTR;; $m/Z=IFDDAYK;; $m/Z=SQLSCVVVDDIER;; $m/Z=LLDYVPIGPR;; $m/Z=LLIIGTTSRK;; $m/Z=LLMoxLIEMoxSLQMDPEYR;; $m/Z=LLMoxLIEMoxSLQMoxDPEYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 812.4756 (0), 830.4222 (0), 871.4456 (0), 903.505 (0),
  913.4565 (0), 1101.676 (0), 1137.5739 (0), 1142.6725 (0),
  1201.7307 (0), 1207.5767 (0), 1231.6635 (0), 1291.6799 (0),
  1295.6885 (0), 1335.6595 (0), 1490.7338 (0), 1519.7568 (0),
  1549.7563 (0), 1688.922 (0), 1700.837 (0), 2013.9709 (0),
  2029.9597 (0), 2199.1414 (0), 3460.8284 (0)
  }
[Click to access protein entry]
 Spot: 638 (ob21dsub)
 pI: 4.66 Mw: 26000
 %vol: 0.159731   %od: 0.140909
 ================
 *SNP25_RAT*
  accession n°: P60881

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ADQLADESLESTRR;; $m/Z=MLQLVEESKDAGIR;; $m/Z=MoxLQLVEESKDAGIR;; $m/Z=TLVMoxLDEQGEQLER;; $m/Z=TRIDEANQR;; $m/Z=AWGNNQDGVVASQPAR;; $m/Z=VVDEREQMAISGGFIR;; $m/Z=VVDEREQMoxAISGGFIR;; $m/Z=EQMoxAISGGFIR;; $m/Z=EQMoxAISGGFIRR;; $m/Z=VTNDARENEMoxDENLEQVSGIIGNLR;; $m/Z=ENEMoxDENLEQVSGIIGNLR;; $m/Z=HMoxALDMoxGNEIDTQNR;; $m/Z=QIDRIMoxEK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1048.516 (0), 1102.5272 (0), 1224.5765 (0),
  1380.677 (0), 1588.8102 (0), 1590.7614 (0), 1604.8058 (0),
  1669.7784 (0), 1676.7897 (0), 1776.7428 (0), 1806.897 (0),
  1822.885 (0), 2175.9956 (0), 2832.3311 (0)
  }
[Click to access protein entry]
 Spot: 404 (ob21dsub)
 pI: 7.32 Mw: 46000
 %vol: 0.206441   %od: 0.249288
 ================
 *CISY_RAT*
  accession n°: Q8VHF5

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=ALGFPLERPK;; $m/Z=AYAEGINR;; $m/Z=VVPGYGHAVLR;; $m/Z=ALGVLAQLIWSR;; $m/Z=DYIWNTLNSGR;; $m/Z=LLGAKNSSCcamLVLAAR;; $m/Z=LRDYIWNTLNSGR;; $m/Z=GLVYETSVLDPDEGIR;; $m/Z=TVVGQITVDMoxMoxYGGMR;; $m/Z=TVVGQITVDMoxMoxYGGMoxR;; $m/Z=LVAQLYK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 834.5142 (0), 893.4719 (0), 1127.6884 (0),
  1167.6937 (0), 1326.8236 (0), 1338.676 (0), 1572.8187 (0),
  1607.8584 (0), 1762.9175 (0), 1789.8672 (0), 1805.844 (0)
  }
[Click to access protein entry]
 Spot: 508 (ob21dsub)
 pI: 5.61 Mw: 39000
 %vol: 0.378121   %od: 0.258713
 ================
 *LDHB_RAT*
  accession n°: P42123

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LKDDEVAQLR;; $m/Z=LKGEMoxMoxDLQHGSLFLQTPK;; $m/Z=LIAPVADDETAVPNNK;; $m/Z=SLADELALVDVLEDK;; $m/Z=GEMoxMoxDLQHGSLFLQTPK;; $m/Z=IVVVTAGVR;; $m/Z=FIIPQIVK;; $m/Z=VIGSGCNLDSAR;; $m/Z=MoxVVDSAYEVIK;; $m/Z=MoxVVDSAYEVIKLK;; $m/Z=IHPVSTMVK;; $m/Z=IHPVSTMoxVK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 913.6193 (0), 957.6376 (0), 1011.5737 (0),
  1027.5829 (0), 1186.6873 (0), 1248.6494 (0), 1269.6606 (0),
  1510.8015 (0), 1629.8795 (0), 1666.8806 (0), 1963.9652 (0),
  2205.1235 (0) }
[Click to access protein entry]
 Spot: 491 (ob21dsub)
 pI: 6.92 Mw: 40000
 %vol: 0.17137   %od: 0.130492
 ================
 *AK1A1_RAT*
  accession n°: P51635

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GLEVTAYSPLGSSDR;; $m/Z=HPDEPVLLEEPVVLALAEK;; $m/Z=SPAQILLR;; $m/Z=QLDALNKNWR;; $m/Z=YIVPMoxITVDGK;; $m/Z=YIVPMoxITVDGKR;; $m/Z=YALSVGYR;; $m/Z=DAGHPLYPFNDPY;; $m/Z=HIDCASVYGNETEIGEALK;; $m/Z=AVPREELFVTSK;; $m/Z=HHPEDVEPAVR;; $m/Z=ALEALVAK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 814.4672 (0), 897.5851 (0), 928.5261 (0),
  1251.6714 (0), 1257.715 (0), 1285.6788 (0), 1375.7897 (0),
  1407.7797 (0), 1505.6957 (0), 1551.8016 (0), 2098.1282 (0),
  2105.9946 (0) }
[Click to access protein entry]
 Spot: 545 (ob21dsub)
 pI: 5.46 Mw: 31000
 %vol: 0.0930629   %od: 0.163075
 ================
 *SNAB_RAT*
  accession n°: P85969

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AIEIYEQVGANTMoxDNPLLK;; $m/Z=EAVQLMoxAEAEKR;; $m/Z=ASHSFLR;; $m/Z=GLFGGNTR;; $m/Z=IEEACEMoxYTR;; $m/Z=KADPQEAINCLNAAIDIYTDMoxGR;; $m/Z=HHITIAEIYETELVDIEK;; $m/Z=AIAHYEQSADYYK;; $m/Z=AIAHYEQSADYYKGEESNSSANK;; $m/Z=VAAYAAQLEQYQK;; $m/Z=AALCHFIVDELNAK;; $m/Z=YEEMoxFPAFTDSR;; $m/Z=KLLEAHEEQNSEAYTEAVK;; $m/Z=LLEAHEEQNSEAYTEAVK;; $m/Z=EFDSISR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 817.4662 (0), 821.4614 (0), 853.4439 (0),
  1317.6028 (0), 1390.7554 (0), 1482.8071 (0), 1508.6838 (0),
  1558.7844 (0), 1600.8563 (0), 2061.0291 (0), 2135.1028 (0),
  2153.1492 (0), 2189.1387 (0), 2562.1753 (0), 2595.2458 (0)
  }
[Click to access protein entry]
 Spot: 682 (ob21dsub)
 pI: 7.19 Mw: 22000
 %vol: 0.0492666   %od: 0.0912023
 ================
 *GSTP1_RAT*
  accession n°: P04906

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=PPYTIVYFPVR;; $m/Z=STCLYGQLPK;; $m/Z=FEDGDLTLYQSNAILR;; $m/Z=EAALVDMVNDGVEDLR;; $m/Z=EAALVDMoxVNDGVEDLR;; $m/Z=YGTLIYTNYENGKDDYVK;; $m/Z=ALPGHLKPFETLLSQNQGGK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1166.5642 (0), 1351.7255 (0), 1745.7999 (0),
  1761.7708 (0), 1854.8756 (0), 2135.0737 (0), 2155.9192 (0)
  }
[Click to access protein entry]
 Spot: 528 (ob21dsub)
 pI: 5.92 Mw: 37000
 %vol: 0.369589   %od: 0.301289
 ================
 *MDHC_RAT*
  accession n°: O88989

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AISDHIR;; $m/Z=EKMDLTAK;; $m/Z=ENFSCcamLTR;; $m/Z=GEFITTVQQR;; $m/Z=DLDVAVLVGSMoxPR;; $m/Z=FVEGLPINDFSR;; $m/Z=LSSAMSAAKAISDHIR;; $m/Z=EVGVYEALKDDSWLK;; $m/Z=NVIIWGNHSSTQYPDVNHAK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 811.4625 (0), 935.4923 (0), 1026.5094 (0),
  1178.6492 (0), 1387.7501 (0), 1393.749 (0), 1657.8436 (0),
  1751.916 (0), 2280.157 (0) }
[Click to access protein entry]
 Spot: 347 (ob21dsub)
 pI: 6.30 Mw: 50000
 %vol: 0.110041   %od: 0.146949
 ================
 *RUVB1_RAT*
  accession n°: P60123

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=CDTYATEFDLEAEEYVPLPK;; $m/Z=ALESSIAPIVIFASNR;; $m/Z=GTEDITSPHGIPLDLLDR;; $m/Z=AQTEGINISEEALNHLGEIGTK;; $m/Z=YSVQLLTPANLLAK;; $m/Z=EHVEEISELFYDAK;; $m/Z=VEAGDVIYIEANSGAVKR;; $m/Z=VEAGDVIYIEANSGAVK;; $m/Z=ERVEAGDVIYIEANSGAVK;; $m/Z=TISHVIIGLK;; $m/Z=EVYEGEVTELTPCETENPMoxGGYGK;; $m/Z=TEVLMoxENFR;; $m/Z=TEVLMENFR;; $m/Z=KTEVLMoxENFR;; $m/Z=KTEVLMENFR;; $m/Z=VPFCPMVGSEVYSTEIK;; $m/Z=TALALAIAQELGSK;; $m/Z=EACGVIVELIK;; $m/Z=QAASGLVGQENAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1080.6689 (0), 1138.592 (0), 1154.5807 (0),
  1230.682 (0), 1266.6826 (0), 1282.6697 (0), 1300.6893 (0),
  1385.7877 (0), 1530.8912 (0), 1687.9678 (0), 1708.858 (0),
  1734.8949 (0), 1891.0107 (0), 1942.9384 (0), 1949.0229 (0),
  2020.0541 (0), 2324.179 (0), 2390.0703 (0), 2705.177 (0)
  }
[Click to access protein entry]
 Spot: 661 (ob21dsub)
 pI: 7.21 Mw: 24000
 %vol: 0.0879305   %od: 0.107447
 ================
 *GSTM4_RAT*
  accession n°: P08009

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YTMoxGDAPDFDR;; $m/Z=VDILENQLMoxDNR;; $m/Z=LKPGYLEQLPGMoxMoxR;; $m/Z=LLLEYTDSSYEEK;; $m/Z=IRVDILENQLMoxDNR;; $m/Z=LLLEYTDSSYEEKR;; $m/Z=LGLDFPNLPYLIDGSHK;; $m/Z=RPWFAGDK;; $m/Z=ITQSNAILR;; $m/Z=PMoxTLGYWDIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 976.4736 (0), 1015.5613 (0), 1267.5883 (0),
  1303.5079 (0), 1475.7007 (0), 1589.7749 (0), 1664.8204 (0),
  1744.8717 (0), 1745.8564 (0), 1898.976 (0)
  }
[Click to access protein entry]
 Spot: 610 (ob21dsub)
 pI: 5.39 Mw: 28000
 %vol: 0.0782356   %od: 0.161412
 ================
 *PSA3_RAT*
  accession n°: P18422

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=AVENSSTAIGIR;; $m/Z=LYEEGSNKR;; $m/Z=RLFNVDR;; $m/Z=HVGMAVAGLLADAR;; $m/Z=HVGMoxAVAGLLADAR;; $m/Z=EEASNFR;; $m/Z=SNFGYNIPLK;; $m/Z=IIYIVHDEVK;; $m/Z=IIYIVHDEVKDK;; $m/Z=AFELELSWVGELTK;; $m/Z=GRHEIVPK;; $m/Z=VFQVEYAMoxK;; $m/Z=VFQVEYAMK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 852.4158 (0), 919.5047 (0), 935.5663 (0),
  1095.5854 (0), 1114.589 (0), 1130.5785 (0), 1152.6293 (0),
  1217.6909 (0), 1228.7133 (0), 1380.7804 (0), 1396.7672 (0),
  1471.8136 (0), 1621.8721 (0) }
[Click to access protein entry]
 Spot: 256 (ob21dsub)
 pI: 6.34 Mw: 62000
 %vol: 0.0549015   %od: 0.105152
 ================
 *MAOX_RAT*
  accession n°: P13697

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=HINDSVFLTTAEVISQQVSDK;; $m/Z=VRGPEYDAFLDEFMoxEAASSK;; $m/Z=LYPPLNTIR;; $m/Z=YGMoxNCLIQFEDFANLNAFR;; $m/Z=YCTFNDDIQGTASVAVAGLLAALR;; $m/Z=DMoxAAFNERPIIFALSNPTSK;; $m/Z=DLAFTLEER;; $m/Z=YLLLMoxDLQDR;; $m/Z=AIVVTDGER;; $m/Z=AIFASGSPFDPVTLPDGR;; $m/Z=TLFPGQGNNSYVFPGVALGVVACGLR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 959.489 (0), 1086.6135 (0), 1093.5286 (0),
  1295.618 (0), 1846.8777 (0), 2238.0327 (0), 2277.949 (0),
  2331.1106 (0), 2338.9788 (0), 2526.1909 (0), 2693.2866 (0)
  }
[Click to access protein entry]
 Spot: 333 (ob21dsub)
 pI: 7.55 Mw: 51000
 %vol: 0.21996   %od: 0.255493
 ================
 *ATPA_RAT*
  accession n°: P15999

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=GIRPAINVGLSVSR;; $m/Z=EAYPGDVFYLHSR;; $m/Z=QGQYSPMoxAIEEQVAVIYAGVR;; $m/Z=EVAAFAQFGSDLDAATQQLLSR;; $m/Z=FESAFLSHVVSQHQSLLGNIR;; $m/Z=LELAQYR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 892.4569 (0), 1438.7863 (0), 1553.6726 (0),
  2325.0471 (0), 2338.0691 (0), 2369.1206 (0)
  }
[Click to access protein entry]
 Spot: 510 (ob21dsub)
 pI: 5.46 Mw: 39000
 %vol: 0.0397344   %od: 0.117191
 ================
 *CAZA1_RAT*
  accession n°: B2GUZ5

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=FDHLRK;; $m/Z=TIDGQQTIIACIESHQFQPK;; $m/Z=FTITPPTAQVVGVLK;; $m/Z=IQVHYYEDGNVQLVSHK;; $m/Z=FITHAPPGEFNEVFNDVR;; $m/Z=LLLNNDNLLR;; $m/Z=EGAAHAFAQYNMoxDQFTPVK;; $m/Z=IEGYDDQVLITEHGDLGNSR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 815.4406 (0), 1197.6975 (0), 1570.8981 (0),
  2028.9901 (0), 2088.9944 (0), 2140.9478 (0), 2231.0354 (0),
  2314.1184 (0) }
[Click to access protein entry]
 Spot: 614 (ob21dsub)
 pI: 4.90 Mw: 28000
 %vol: 0.961596   %od: 0.228206
 ================
 *CALB2_RAT*
  accession n°: P47728

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LTSEEFNAIFTFYDK;; $m/Z=LGLSEMSR;; $m/Z=LQEYTQTILR;; $m/Z=LLPVQENFLLK;; $m/Z=ELENFFQELEK;; $m/Z=QHVGSSAEFMEAWR;; $m/Z=QHVGSSAEFMoxEAWR;; $m/Z=QHVGSSAEFMEAWRK;; $m/Z=DGSGYIDENELDALLKDLYEK;; $m/Z=IEMoxAELAQILPTEENFLLCcamFR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 892.4753 (0), 1264.6562 (0), 1313.7476 (0),
  1425.6495 (0), 1634.6904 (0), 1650.6993 (0), 1762.8528 (0),
  1824.8352 (0), 2400.1284 (0), 2553.2688 (0)
  }
[Click to access protein entry]
 Spot: 423 (ob21dsub)
 pI: 7.79 Mw: 46000
 %vol: 0.127195   %od: 0.156481
 ================
 *PGK1_RAT*
  accession n°: P16617

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NNQITNNQRIK;; $m/Z=DCVGSEVENACANPAAGTVILLENLR;; $m/Z=LGDVYVNDAFGTAHR;; $m/Z=ELNYFAK;; $m/Z=ALESPERPFLAILGGAK;; $m/Z=VNEMoxIIGGGMoxAFTFLK;; $m/Z=VLNNMoxEIGTSLYDEEGAK;; $m/Z=VSHVSTGGGASLELLEGK;; $m/Z=QIVWNGPVGVFEWEAFAR;; $m/Z=ITLPVDFVTADKFDENAK;; $m/Z=ITLPVDFVTADK;; $m/Z=NNQITNNQR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 884.4624 (0), 1101.5648 (0), 1318.7371 (0),
  1342.7396 (0), 1634.8204 (0), 1740.9377 (0), 1759.8942 (0),
  1769.0271 (0), 1998.9541 (0), 2023.061 (0), 2105.0854 (0),
  2772.3574 (0) }
[Click to access protein entry]
 Spot: 785 (ob21dsub)
 pI: 5.92 Mw: 56000
 %vol: 0.0494761   %od: 0.208175
 ================
 *G6PD_RAT*
  accession n°: P05370

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LPDAYER;; $m/Z=TQVCGILR;; $m/Z=IYPTIWWLFR;; $m/Z=DGLLPEDTFIVGYAR;; $m/Z=LTVDDIR;; $m/Z=LEEFFAR;; $m/Z=NSYVAGQYDDPASYK;; $m/Z=HLNSHMoxNALHQGMoxQANR;; $m/Z=LFYLALPPTVYEAVTK;; $m/Z=IIVEKPFGR;; $m/Z=DLQSSNQLSNHISSLFR;; $m/Z=EDQIYR;; $m/Z=EMoxVQNLMoxVLR;; $m/Z=EMoxVQNLMoxVLRFANR;; $m/Z=IFGPIWNR;; $m/Z=DNIACVILTFKEPFGTEGR;; $m/Z=EPFGTEGR;; $m/Z=GGYFDEFGIIR;; $m/Z=WDGVPFILR;; $m/Z=AEVRLQFR;; $m/Z=DVAGDIFHQQCK;; $m/Z=KPGMoxFFNPEESELDLTYGNR;; $m/Z=LILDVFCGSQMoxHFVR;; $m/Z=EKPQPIPYVYGSR;; $m/Z=VGFQYEGTYK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 823.4207 (0), 831.4815 (0), 863.4567 (0), 892.452 (0),
  911.4937 (0), 946.5486 (0), 1002.5922 (0), 1018.586 (0),
  1058.6742 (0), 1102.6472 (0), 1191.6128 (0), 1264.6934 (0),
  1273.6682 (0), 1394.811 (0), 1417.7178 (0), 1533.8542 (0),
  1665.8954 (0), 1677.8188 (0), 1752.8689 (0), 1825.0458 (0),
  1837.953 (0), 1946.0248 (0), 1990.9713 (0), 2167.1453 (0),
  2360.1389 (0) }
[Click to access protein entry]
 Spot: 353 (ob21dsub)
 pI: 5.35 Mw: 49000
 %vol: 0.206057   %od: 0.234565
 ================
 *GFAP_RAT*
  accession n°: P47819

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VESLEEEIQFLR;; $m/Z=HLQEYQDLLNVK;; $m/Z=VESLEEEIQFLRK;; $m/Z=ITIPVQTFSNLQIR;; $m/Z=VDFSLAGALNAGFKETR;; $m/Z=MoxTPPLPARVDFSLAGALNAGFK;; $m/Z=TQYEAVATSNMQETEEWYR;; $m/Z=LLEGEENRITIPVQTFSNLQIR;; $m/Z=ELQEQLAQQQVHVEMDVAKPDLTAALR;; $m/Z=ELQEQLAQQQVHVEMoxDVAKPDLTAALR;; $m/Z=VDFSLAGALNAGFK;; $m/Z=LALDIEIATYRK;; $m/Z=LEAENNLAVYR;; $m/Z=LALDIEIATYR;; $m/Z=DNLTQDLGTLR;; $m/Z=ESASYQEALAR;; $m/Z=LADVYQAELR;; $m/Z=ALAAELNQLR;; $m/Z=FADLTDVASR;; $m/Z=LQDETNLR;; $m/Z=IHEEEVR;; $m/Z=MoxTPPLPAR;; $m/Z=FASYIEK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 857.4159 (0), 898.448 (0), 911.4208 (0), 988.4747 (0),
  1094.5219 (0), 1098.5964 (0), 1177.5874 (0), 1224.5508 (0),
  1245.6106 (0), 1277.6831 (0), 1291.6356 (0), 1405.7784 (0),
  1409.7112 (0), 1491.7401 (0), 1499.7526 (0), 1619.8335 (0),
  1629.8988 (0), 1795.8992 (0), 2289.1685 (0), 2351.9714 (0),
  2570.3469 (0), 3060.4924 (0), 3076.5403 (0)
  }
[Click to access protein entry]
 Spot: 564 (ob21dsub)
 pI: 6.84 Mw: 34000
 %vol: 0.0807014   %od: 0.146418
 ================
 *ARPC2_RAT*
  accession n°: P85970

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=MILLEVNNR;; $m/Z=DYLHYHIK;; $m/Z=AVIHYRDDETMoxYVESK;; $m/Z=YFQFQEEGKEGENR;; $m/Z=YFQFQEEGK;; $m/Z=DSIVHQAGMoxLK;; $m/Z=ELQAHGADELLK;; $m/Z=IIEETLALK;; $m/Z=MoxILLEVNNR;; $m/Z=DNTINLIHTFR;; $m/Z=DTDAAVGDNIGYITFVLFPR;; $m/Z=ASHTAPQVLFSHR;; $m/Z=RASHTAPQVLFSHR;; $m/Z=VFMoxQEFK;; $m/Z=VFMQEFK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 928.4806 (0), 944.4727 (0), 1029.6384 (0),
  1088.5826 (0), 1101.5914 (0), 1117.6298 (0), 1175.5676 (0),
  1214.6411 (0), 1323.7151 (0), 1343.7426 (0), 1450.7936 (0),
  1606.8947 (0), 1760.8295 (0), 1971.9442 (0), 2184.1328 (0)
  }
[Click to access protein entry]
 Spot: 493 (ob21dsub)
 pI: 8.07 Mw: 40000
 %vol: 0.826737   %od: 0.264671
 ================
 *G3P_RAT*
  accession n°: P04797

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=VIISAPSADAPMoxFVMoxGVNHEK;; $m/Z=RVIISAPSADAPMoxFVMoxGVNHEK;; $m/Z=VIHDNFGIVEGLMoxTTVHAITATQK;; $m/Z=VGVNGFGR;; $m/Z=LTGMoxAFR;; $m/Z=TVDGPSGKLWR;; $m/Z=VVDLMAYMASK;; $m/Z=LVINGKPITIFQER;; $m/Z=LISWYDNEYGYSNR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 805.4476 (0), 811.4228 (0), 1215.752 (0),
  1227.6593 (0), 1627.9846 (0), 1779.8378 (0), 2245.1448 (0),
  2401.2297 (0), 2611.417 (0) }
[Click to access protein entry]
 Spot: 427 (ob21dsub)
 pI: 8.69 Mw: 45000
 %vol: 0.117341   %od: 0.173185
 ================
 *QCR2_RAT*
  accession n°: P32551

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TSAPGGVPLQPQELEFTK;; $m/Z=YENYNYLGTSHLLR;; $m/Z=AVAFQNPQTR;; $m/Z=IIENLHDVAYK;; $m/Z=ITSEELHYFVQNHFTSAR;; $m/Z=EVAEQFLNIR;; $m/Z=YRGGEIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 850.4726 (0), 1131.6235 (0), 1218.6788 (0),
  1314.7295 (0), 1742.8763 (0), 1898.9847 (0), 2179.073 (0)
  }
[Click to access protein entry]
 Spot: 397 (ob21dsub)
 pI: 5.39 Mw: 47000
 %vol: 0.114152   %od: 0.197806
 ================
 *IF4A2_RAT*
  accession n°: Q5RKI1

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DFTVSALHGDMoxDQKER;; $m/Z=SGGSADYNR;; $m/Z=GIYAYGFEKPSAIQQR;; $m/Z=GYDVIAQAQSGTGK;; $m/Z=ETQALVLAPTR;; $m/Z=LQAEAPHIVVGTPGR;; $m/Z=VFDMoxLNR;; $m/Z=VFDMoxLNRR;; $m/Z=MoxFVLDEADEMoxLSR;; $m/Z=GFKDQIYEIFQK;; $m/Z=DQIYEIFQK;; $m/Z=FMoxRDPIR;; $m/Z=QFYINVER;; $m/Z=VLITTDLLAR;; $m/Z=GIDVQQVSLVINYDLPTNR;; $m/Z=ENYIHR;; $m/Z=GVAINFVTEEDKR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 831.4033 (0), 910.4327 (0), 926.4381 (0), 950.479 (0),
  1066.5337 (0), 1068.5454 (0), 1114.6821 (0), 1183.5892 (0),
  1198.6772 (0), 1394.6799 (0), 1477.7576 (0), 1515.7645 (0),
  1544.8446 (0), 1587.6843 (0), 1827.929 (0), 1864.8346 (0),
  2144.1204 (0) }
[Click to access protein entry]
 Spot: 757 (ob21dsub)
 pI: 5.62 Mw: 18000
 %vol: 0.162915   %od: 0.107116
 ================
 *STMN1_RAT*
  accession n°: P13668

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=SHEAEVLK;; $m/Z=EHEKEVLQK;; $m/Z=DKHVEEVR;; $m/Z=HVEEVRK;; $m/Z=RASGQAFELILSPR;; $m/Z=ASGQAFELILSPR;; $m/Z=SKESVPEFPLSPPK;; $m/Z=ESVPEFPLSPPK;; $m/Z=DLSLEEIQK;; $m/Z=KLEAAEER }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 896.459 (0), 912.4562 (0), 945.4896 (0), 1011.5136 (0),
  1074.5406 (0), 1139.5959 (0), 1326.6537 (0), 1388.7268 (0),
  1541.7693 (0), 1544.8219 (0) }
[Click to access protein entry]
 Spot: 674 (ob21dsub)
 pI: 5.77 Mw: 23000
 %vol: 0.0677707   %od: 0.0837348
 ================
 *PSB4_RAT*
  accession n°: P34067

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=CMRVLYYR;; $m/Z=FDCGVVIAADMLGSYGSLAR;; $m/Z=FDCGVVIAADMoxLGSYGSLAR;; $m/Z=VNDSTMoxLGASGDYADFQYLK;; $m/Z=AIHSWLTR;; $m/Z=QPVLSQTEAR;; $m/Z=FQVATVTEK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 983.5255 (0), 1022.5065 (0), 1128.5746 (0),
  1160.5447 (0), 2101.9458 (0), 2117.9158 (0), 2210.8899 (0)
  }
[Click to access protein entry]
 Spot: 549 (ob21dsub)
 pI: 8.14 Mw: 32000
 %vol: 0.27082   %od: 0.214746
 ================
 *VDAC1_RAT*
  accession n°: Q9Z2L0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LTFDSSFSPNTGK;; $m/Z=EHINLGCDVDFDIAGPSIR;; $m/Z=VTQSNFAVGYK;; $m/Z=TDEFQLHTNVNDGTEFGGSIYQK;; $m/Z=KLETAVNLAWTAGNSNTR;; $m/Z=LETAVNLAWTAGNSNTR;; $m/Z=VNNSSLIGLGYTQTLKPGIK;; $m/Z=GYGFGLIK,20-27;; $m/Z=WTEYGLTFTEK;; $m/Z=WNTDNTLGTEITVEDQLAR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 854.4728 (0), 1213.6273 (0), 1374.6678 (0),
  1400.6741 (0), 1817.9325 (0), 1946.0288 (0), 2103.1875 (0),
  2128.0317 (0), 2176.0662 (0), 2600.198 (0)
  }
[Click to access protein entry]
 Spot: 312 (ob21dsub)
 pI: 6.40 Mw: 52000
 %vol: 0.213983   %od: 0.152824
 ================
 *DHE3_RAT*
  accession n°: P10860

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=DSNYHLLMoxSVQESLER;; $m/Z=DIVHSGLAYTMoxER;; $m/Z=MoxVEGFFDR;; $m/Z=YNLGLDLR;; $m/Z=GFIGPGIDVPAPDMoxSTGER;; $m/Z=TFVVQGFGNVGLHSMoxR;; $m/Z=ELEDFKLQHGSILGFPK;; $m/Z=NLNHVSYGR;; $m/Z=HGGTIPVVPTAEFQDR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 963.5521 (0), 1016.4814 (0), 1059.5674 (0),
  1507.7499 (0), 1723.9036 (0), 1764.9043 (0), 1931.9468 (0),
  1936.9319 (0), 1958.1282 (0) }
[Click to access protein entry]
 Spot: 442 (ob21dsub)
 pI: 7.07 Mw: 44000
 %vol: 0.0752778   %od: 0.124694
 ================
 *AATC_RAT*
  accession n°: P13221

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=NLDYVATSINEAVTK;; $m/Z=LIADFRDDPDPR;; $m/Z=QVEYLVNEK;; $m/Z=IVATTLSNPELFK;; $m/Z=ITWSNPPAQGAR;; $m/Z=EHDSVLR;; $m/Z=NFGLYNER;; $m/Z=RFLFPFFDSAYQGFASGDLEK;; $m/Z=YWDAEKR;; $m/Z=SCASQLVLGDNSPALR;; $m/Z=IANDHSLNHEYLPILGLAEFR;; $m/Z=VNLGVGAYR;; $m/Z=KVNLGVGAYR;; $m/Z=HIYLMoxPSGR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 855.4377 (0), 948.5387 (0), 967.4799 (0),
  1012.5001 (0), 1076.6392 (0), 1089.563 (0), 1121.5864 (0),
  1297.6855 (0), 1429.7286 (0), 1432.8167 (0), 1637.8492 (0),
  1687.8695 (0), 2422.2747 (0), 2442.2031 (0)
  }
[Click to access protein entry]
 Spot: 284 (ob21dsub)
 pI: 5.86 Mw: 57000
 %vol: 0.0868771   %od: 0.168997
 ================
 *TCPE_RAT*
  accession n°: Q68FQ0

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=IADGYEQAAR;; $m/Z=ISDNVLVDINNPEPLIQTAK;; $m/Z=TTLGSKVVNSCHR;; $m/Z=QMoxAEIAVNAVLTVADMoxER;; $m/Z=QMoxAEIAVNAVLTVADMoxERR;; $m/Z=DVDFELIKVEGK;; $m/Z=GVIVDKDFSHPQMoxPK;; $m/Z=IAILTCPFEPPKPK;; $m/Z=EKFEEMoxIAQIK;; $m/Z=WVGGPEIELIAIATGGR;; $m/Z=LGFAGVVR;; $m/Z=MoxLVIEQCK;; $m/Z=AVTIFIR;; $m/Z=QQISLATQMoxVR;; $m/Z=KQQISLATQMoxVR;; $m/Z=SLHDALCVIR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 818.4903 (0), 819.5043 (0), 1036.5355 (0),
  1093.5457 (0), 1183.6357 (0), 1290.6782 (0), 1381.6921 (0),
  1391.7294 (0), 1418.7626 (0), 1458.7463 (0), 1610.8854 (0),
  1713.8479 (0), 1738.9441 (0), 1992.9509 (0), 2149.0505 (0),
  2193.1482 (0) }
[Click to access protein entry]
 Spot: 515 (ob21dsub)
 pI: 8.77 Mw: 38000
 %vol: 0.732062   %od: 0.231852
 ================
 *MDHM_RAT*
  accession n°: P04636

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TIIPLISQCcamTPK;; $m/Z=AGAGSATLSMoxAYAGAR;; $m/Z=GYLGPEQLPDCcamLK;; $m/Z=AKAGAGSATLSMoxAYAGAR;; $m/Z=ETECcamTYFSTPLLLGK;; $m/Z=VAVLGASGGIGQPLSLLLK;; $m/Z=ITPFEEKMIAEAIPELK;; $m/Z=LTLYDIAHTPGVAADLSHIETR;; $m/Z=FVFSLVDAMNGKEGVIECcamSFVQSK;; $m/Z=ITPFEEK;; $m/Z=VNVPVIGGHAGK;; $m/Z=IFGVTTLDIVR;; $m/Z=GCcamDVVVIPAGVPR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 863.4487 (0), 1147.6608 (0), 1233.7351 (0),
  1338.734 (0), 1370.7622 (0), 1470.7198 (0), 1489.7509 (0),
  1669.9016 (0), 1758.8883 (0), 1793.1144 (0), 1959.041 (0),
  2393.2878 (0), 2691.3423 (0) }
[Click to access protein entry]
 Spot: 566 (ob21dsub)
 pI: 5.07 Mw: 33000
 %vol: 0.332517   %od: 0.22239
 ================
 *ANXA5_RAT*
  accession n°: P14668

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=YMoxTISGFQIEETIDR;; $m/Z=GTVTDFSGFDGR;; $m/Z=GLGTDEDSILNLLTAR;; $m/Z=QQIAEEFK;; $m/Z=LIVALMoxKPSR;; $m/Z=LYDAYELK;; $m/Z=VLTEIIASR;; $m/Z=QAYEEEYGSNLEDDVVGDTSGYYQR;; $m/Z=MoxLVVLLQANR;; $m/Z=DPDTAIDDAQVELDAQALFQAGELK;; $m/Z=FITILGTR;; $m/Z=VFDKYMoxTISGFQIEETIDR;; $m/Z=YMTISGFQIEETIDR;; $m/Z=SIPAYLAETLYYAMoxK;; $m/Z=GAGTDDHTLIR;; $m/Z=SEIDLFNIR;; $m/Z=KNFATSLYSMoxIK;; $m/Z=NFATSLYSMoxIK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 920.5625 (0), 992.5104 (0), 1001.6113 (0),
  1014.5206 (0), 1106.598 (0), 1143.6975 (0), 1155.5914 (0),
  1172.6869 (0), 1258.5859 (0), 1290.6467 (0), 1418.7415 (0),
  1687.9036 (0), 1749.8779 (0), 1802.8909 (0), 1818.866 (0),
  2308.126 (0), 2673.2891 (0), 2887.2263 (0)
  }
[Click to access protein entry]
 Spot: 375 (ob21dsub)
 pI: 5.57 Mw: 50000
 %vol: 0.0918662   %od: 0.2174
 ================
 *ARP3_RAT*
  accession n°: Q4V7C7

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=TLTGTVIDSGDGVTHVIPVAEGYVIGSCIK;; $m/Z=DITYFIQQLLR;; $m/Z=HGIVEDWDLMoxER;; $m/Z=DREVGIPPEQSLETAK;; $m/Z=EVGIPPEQSLETAK;; $m/Z=YSYVCPDLVK;; $m/Z=KEFSIDVGYER;; $m/Z=EFSIDVGYER;; $m/Z=GVDDLDFFIGDEAIEKPTYATK;; $m/Z=LGYAGNTEPQFIIPSCIAIK;; $m/Z=FMoxEQVIFK;; $m/Z=AEPEDHYFLLTEPPLNTPENR;; $m/Z=NIVLSGGSTMFR;; $m/Z=KDYEEIGPSICR;; $m/Z=NIVLSGGSTMoxFR;; $m/Z=DYEEIGPSICR }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1057.5404 (0), 1214.5823 (0), 1243.6108 (0),
  1281.6721 (0), 1297.6637 (0), 1338.6152 (0), 1342.6781 (0),
  1409.7889 (0), 1466.7078 (0), 1497.7716 (0), 1515.6914 (0),
  1768.9113 (0), 2192.1147 (0), 2444.1702 (0), 2482.1755 (0),
  3058.5298 (0) }
[Click to access protein entry]
 Spot: 364 (ob21dsub)
 pI: 5.89 Mw: 50000
 %vol: 0.401092   %od: 0.242823
 ================
 *ENOA_RAT*
  accession n°: P04764

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=LAQSNGWGVMoxVSHR;; $m/Z=YNQILR;; $m/Z=DATNVGDEGGFAPNILENK;; $m/Z=IGAEVYHNLK;; $m/Z=LAMoxQEFMoxILPVGASSFR;; $m/Z=LAMoxQEFMILPVGASSFR;; $m/Z=HIADLAGNPEVILPVPAFNVINGGSHAGNK;; $m/Z=IDQLMoxIEMoxDGTENK,89-102;; $m/Z=KLNVVEQEK;; $m/Z=AAVPSGASTGIYEALELR;; $m/Z=GNPTVEVDLYTAK;; $m/Z=AGYTDQVVIGMDVAASEFYR;; $m/Z=AGYTDQVVIGMoxDVAASEFYR;; $m/Z=YDLDFK;; $m/Z=FTATAGIQVVGDDLTVTNPK }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 800.3531 (0), 806.4219 (0), 1086.5831 (0),
  1143.5845 (0), 1406.6753 (0), 1557.7191 (0), 1668.7004 (0),
  1804.9022 (0), 1912.9326 (0), 1928.9114 (0), 1960.8807 (0),
  2047.0095 (0), 2191.9875 (0), 2207.9722 (0), 3021.5076 (0)
  }
World-2DPAGE Repository image

 World-2DPAGE Repository Viewer (0004)
 OB21DSUB { 2-DE gel for Olfactory bulb proteome } (All identified proteins)

Home page of the World-2DPAGE Repository
             Back to the
World-2DPAGE Repository imagesearch engine

Switch to Gel: 

Database: 

Re-scale Gel from 100% to:  View: 


      Display:   Identified spots    Identification details:  show hide
details:  PMF  Tandem MS  AA Composition  Micro-Sequencing / Tagging  Gel Matching  Comigration  Immunobloting
 

  -Get more information by dragging your mouse pointer over any highlighted spot  -Click on a highlighted spot to access all its associated protein entries
/repository/data/gifs/submission_0004/OB21DSUB.jpg
Back to the
World-2DPAGE Repository imagesearch engine