World-2DPAGE Home
Home  |  Contact
[Click to access protein entry]
 Spot: 1D-001V7N (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 0.558614   %od: 0.586832
 ================
 *PRKDC_HUMAN*
  accession n°: P78527

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TVGALQVLGTEAQSSLLK(A);; $m/Z=(R)MoxSTSPEAFLALR(S);; $m/Z=(R)RILELSGSSSEDSEK(V);; $m/Z=(R)STVLTPMFVETQASQGTLQTR(T);; $m/Z=(K)LVINTEEVFRPYAK(H);; $m/Z=(K)NLLIFENLIDLK(R);; $m/Z=(K)NLSSNEAISLEEIR(I) }
[Click to access protein entry]
 Spot: 1D-001VA7 (nucleoli_hela_1d_human)
 pI: N\A Mw: 19877
 %vol: 0.401259   %od: 0.402368
 ================
 *SRP14_HUMAN*
  accession n°: P37108

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(M)VLLESEQFLTELTR(L) }
[Click to access protein entry]
 Spot: 1D-001V8Z (nucleoli_hela_1d_human)
 pI: N\A Mw: 40297
 %vol: 0.668764   %od: 0.605205
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)MSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(R)TVSLGAGAKDELHIVEAEAMoxNYEGSPIK(V);; $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(K)DELHIVEAEAMoxNYEGSPIK(V);; $m/Z=(K)DELHIVEAEAMNYEGSPIK(V);; $m/Z=(R)MoxTDQEAIQDLWQWR(K);; $m/Z=(K)LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK(A) }
[Click to access protein entry]
 Spot: 1D-001V9C (nucleoli_hela_1d_human)
 pI: N\A Mw: 32825
 %vol: 0.802518   %od: 0.792977
 ================
 *RL7A_HUMAN*
  accession n°: P62424

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LKVPPAINQFTQALDR(Q);; $m/Z=(R)AGVNTVTTLVENK(K) }
[Click to access protein entry]
 Spot: 1D-001V9R (nucleoli_hela_1d_human)
 pI: N\A Mw: 26658
 %vol: 0.566483   %od: 0.618801
 ================
 *RL15_HUMAN*
  accession n°: P61313

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)FFEVILIDPFHK(A) }
[Click to access protein entry]
 Spot: 1D-001V7R (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 1.07002   %od: 1.13692
 ================
 *NPA1P_HUMAN*
  accession n°: O60287

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)DPVLAPAVGADLLDYCLAR(R);; $m/Z=(R)ILLTLVANPYSYTDK(A);; $m/Z=(K)ISVECVEIFQLLSGEK(R) }

  ================
 *RPA1_HUMAN*
  accession n: O95602

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AALNLPEAASYDEVR(G);; $m/Z=(K)LPEEVATPTTDEEK(D) }

  ================
 *RRP5_HUMAN*
  accession n: Q14690

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TTEPGVTGLLLAVEGPAAK(R);; $m/Z=(R)IIDYSQMoxDELALLSLR(T);; $m/Z=(R)TSIIEAQYLR(Y);; $m/Z=(K)HELSTEYIPDPER(V);; $m/Z=(K)VVILNVDLLK(L);; $m/Z=(K)VTPNEGLTVSFPFGK(I);; $m/Z=(K)SKVEDPEINSIQDIK(E);; $m/Z=(K)VFLHLADIYAKSEK(F);; $m/Z=(K)FQEAGELYNR(M) }

  ================
 *HEAT1_HUMAN*
  accession n: Q9H583

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TIQQLETVLGEPLQSYF(-);; $m/Z=(K)YNEFSVSLLNEDPK(S);; $m/Z=(K)MoxVEDLISVGEEESFNLK(Q);; $m/Z=(K)VSLLNEQFLPLIR(L);; $m/Z=(R)GLVGNPLPSVR(R);; $m/Z=(K)VNALLPTETFIPVIR(G);; $m/Z=(R)LDDTYSFQVINK(T);; $m/Z=(K)QLILSCLLNICQK(L);; $m/Z=(K)TDEAFFDSENDPEK(C);; $m/Z=(K)NSHCAQTVSSVFK(G);; $m/Z=(K)VVESGGPEILK(G);; $m/Z=(K)VTMoxENTFVNSLASQIIK(T);; $m/Z=(R)TLDVVLEEHLK(E);; $m/Z=(R)LLTFYNLADCIAEK(L);; $m/Z=(R)LALPQSDASLLSR(D);; $m/Z=(K)LSEVTFRPLFFK(L) }
[Click to access protein entry]
 Spot: 1D-001V8M (nucleoli_hela_1d_human)
 pI: N\A Mw: 50927
 %vol: 0.896932   %od: 0.951352
 ================
 *WDR12_HUMAN*
  accession n°: Q9GZL7

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SIMoxTIVGHTDVVK(D);; $m/Z=(K)HVEFDFLIK(G);; $m/Z=(K)SIMTIVGHTDVVK(D);; $m/Z=(R)VWDVESGSLK(S);; $m/Z=(K)VFNCISYSPLCK(R);; $m/Z=(K)APLYDLAAHEDK(V);; $m/Z=(K)VLSVDWTDTGLLLSGGADNK(L) }

  ================
 *DDX47_HUMAN*
  accession n: Q9H0S4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AITFVTQYDVELFQR(I);; $m/Z=(R)NLGFTAIPLHGQMoxSQSK(R);; $m/Z=(K)TGAFALPILNALLETPQR(L);; $m/Z=(K)LQQYYIFIPSK(F);; $m/Z=(R)NLGFTAIPLHGQMSQSK(R);; $m/Z=(R)SILLATDVASR(G);; $m/Z=(K)IQIEAIPLALQGR(D) }

  ================
 *NLE1_HUMAN*
  accession n: Q9NVX2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VLDIIYQPQAIFR(V) }
[Click to access protein entry]
 Spot: 1D-001V9T (nucleoli_hela_1d_human)
 pI: N\A Mw: 25490
 %vol: 0.645162   %od: 0.679065
 ================
 *RL18_HUMAN*
  accession n°: Q07020

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TAVVVGTITDDVR(V);; $m/Z=(K)ILTFDQLALDSPK(G) }
[Click to access protein entry]
 Spot: 1D-001V83 (nucleoli_hela_1d_human)
 pI: N\A Mw: 80325
 %vol: 1.24312   %od: 1.35776
 ================
 *NOL11_HUMAN*
  accession n°: Q9H8H0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ILSVQGTEPLVLFK(E) }

  ================
 *DDX18_HUMAN*
  accession n: Q9NVP1

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)VPLSEFDFSWSK(I);; $m/Z=(K)LGNGINIIVATPGR(L) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 927.4 (0), 1040.6 (0), 1247.6 (0), 1252.7 (0), 1263.6 (0),
  1291.7 (0), 1315.7 (0), 1441.7 (0), 1445.7 (0), 1628.8 (0), 1710.8 (0),
  1726.8 (0), 1940.9 (0), 2037 (0), 2136 (0), 2271.2 (0), 2311.1 (0),
  3064.5 (0) }
[Click to access protein entry]
 Spot: 1D-001V8I (nucleoli_hela_1d_human)
 pI: N\A Mw: 55139
 %vol: 0.629425   %od: 0.662896
 ================
 *NUCL_HUMAN*
  accession n°: P19338

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)FGYVDFESAEDLEK(A);; $m/Z=(K)GYAFIEFASFEDAK(E) }

  ================
 *IMA2_HUMAN*
  accession n: P52292

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LLGASELPIVTPALR(A) }

  ================
 *TBA1B_HUMAN*
  accession n: P68363

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)NLDIERPTYTNLNR(L);; $m/Z=(R)AVFVDLEPTVIDEVR(T);; $m/Z=(K)VGINYQPPTVVPGGDLAK(V) }

  ================
 *TBB2C_HUMAN*
  accession n: P68371

   Identification Methods:
  * MAPPING: {PMF}

  ================
 *BYST_HUMAN*
  accession n: Q13895

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LQPHPQLSPEIR(R);; $m/Z=(K)GILIPLCESGTCTLR(E) }

  ================
 *PRP19_HUMAN*
  accession n: Q9UMS4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TVPEELVKPEELSK(Y) }
[Click to access protein entry]
 Spot: 1D-001V9Q (nucleoli_hela_1d_human)
 pI: N\A Mw: 27022
 %vol: 0.771047   %od: 0.722425
 ================
 *RL15_HUMAN*
  accession n°: P61313

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VLNSYWVGEDSTYK(F);; $m/Z=(R)NPDTQWITKPVHK(H) }
[Click to access protein entry]
 Spot: 1D-001V7V (nucleoli_hela_1d_human)
 pI: N\A Mw: 110447
 %vol: 1.04642   %od: 1.16742
 ================
 *CEBPZ_HUMAN*
  accession n°: Q03701

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)KLETEETVPETDVETK(K);; $m/Z=(K)EESQIPVDEVFFHR(Y);; $m/Z=(K)ELLITDLLPDNR(K) }

  ================
 *DHX9_HUMAN*
  accession n: Q08211

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ELDALDANDELTPLGR(I);; $m/Z=(K)AENNSEVGASGYGVPGPTWDR(G);; $m/Z=(R)KEEQEVQATLESEEVDLNAGLHGNWTLENAK(A);; $m/Z=(K)KLAAQSCALSLVR(Q);; $m/Z=(K)LAAQSCALSLVR(Q);; $m/Z=(R)QLYHLGVVEAYSGLTK(K);; $m/Z=(K)KFESEILEAISQNSVVIIR(G);; $m/Z=(K)TTQVPQFILDDFIQNDR(A);; $m/Z=(R)GISHVIVDEIHER(D);; $m/Z=(R)YQILPLHSQIPR(E);; $m/Z=(R)KVFDPVPVGVTK(V);; $m/Z=(R)TPLHEIALSIK(L);; $m/Z=(R)LGGIGQFLAK(A);; $m/Z=(K)LQISHEAAACITGLR(A);; $m/Z=(K)KVQSDGQIVLVDDWIK(L);; $m/Z=(K)AIEPPPLDAVIEAEHTLR(E);; $m/Z=(K)YPSPFFVFGEK(I) }

  ================
 *Q12803_HUMAN*
  accession n: Q12803

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GMoxTLVTPLQLLLFASK(K) }

  ================
 *UBP36_HUMAN*
  accession n: Q9P275

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SVSDTYDPYLDVALEIR(Q) }
[Click to access protein entry]
 Spot: 1D-001V99 (nucleoli_hela_1d_human)
 pI: N\A Mw: 34109
 %vol: 0.826121   %od: 0.893293
 ================
 *NSA2_HUMAN*
  accession n°: O95478

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GTVIEVNVSELGLVTQGGK(V) }

  ================
 *RS3A_HUMAN*
  accession n: P61247

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VFEVSLADLQNDEVAFR(K) }
[Click to access protein entry]
 Spot: 1D-001V9U (nucleoli_hela_1d_human)
 pI: N\A Mw: 24909
 %vol: 0.346184   %od: 0.368194
 ================
 *RS5_HUMAN*
  accession n°: P46782

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)WSTDDVQINDISLQDYIAVK(E) }
[Click to access protein entry]
 Spot: 1D-001V9I (nucleoli_hela_1d_human)
 pI: N\A Mw: 30626
 %vol: 0.369788   %od: 0.400898
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L) }
[Click to access protein entry]
 Spot: 1D-001VAA (nucleoli_hela_1d_human)
 pI: N\A Mw: 18667
 %vol: 0.999213   %od: 0.745942
 ================
 *RL27_HUMAN*
  accession n°: P61353

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DVFRDPALK(R);; $m/Z=(K)VYNYNHLMoxPTR(Y) }
[Click to access protein entry]
 Spot: 1D-001V82 (nucleoli_hela_1d_human)
 pI: N\A Mw: 82958
 %vol: 1.19591   %od: 0.955398
 ================
 *XRCC5_HUMAN*
  accession n°: P13010

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TDTLEDLFPTTK(I);; $m/Z=(K)SQLDIIIHSLK(K);; $m/Z=(R)HIEIFTDLSSR(F) }

  ================
 *NOL11_HUMAN*
  accession n: Q9H8H0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)IETVISDEEVIK(W);; $m/Z=(R)KIEVSLQPEVPPSK(Q);; $m/Z=(K)YTLLLGQDENSVIK(S);; $m/Z=(R)ILSVQGTEPLVLFK(E) }

  ================
 *RED2_HUMAN*
  accession n: Q9NS39

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ALDLVGPTPATPAAPGER(N) }

  ================
 *DDX18_HUMAN*
  accession n: Q9NVP1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VPLSEFDFSWSK(I);; $m/Z=(K)NLQCLVIDEADR(I);; $m/Z=(K)LGNGINIIVATPGR(L);; $m/Z=(K)VPPFVDLNVNSNEGK(Q) }
[Click to access protein entry]
 Spot: 1D-001V9Y (nucleoli_hela_1d_human)
 pI: N\A Mw: 23274
 %vol: 0.416994   %od: 0.42956
 ================
 *RL21_HUMAN*
  accession n°: P46778

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VYNVTQHAVGIVVNK(Q);; $m/Z=(R)TNGKEPELLEPIPYEFMoxA(-) }
[Click to access protein entry]
 Spot: 1D-001V8Y (nucleoli_hela_1d_human)
 pI: N\A Mw: 41199
 %vol: 0.448465   %od: 0.483209
 ================
 *H2AY_HUMAN*
  accession n°: O75367

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GVTIASGGVLPNIHPELLAK(K);; $m/Z=(R)HILLAVANDEELNQLLK(G) }

  ================
 *NPM_HUMAN*
  accession n: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TVSLGAGAKDELHIVEAEAMoxNYEGSPIK(V);; $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(K)MSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(R)MoxTDQEAIQDLWQWR(K) }
[Click to access protein entry]
 Spot: 1D-001V8H (nucleoli_hela_1d_human)
 pI: N\A Mw: 56716
 %vol: 0.849725   %od: 0.900643
 ================
 *U3IP2_HUMAN*
  accession n°: O43818

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)FSSSGDFLVAGVGQEHR(L) }

  ================
 *VIME_HUMAN*
  accession n: P08670

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ISLPLPNFSSLNLR(E);; $m/Z=(R)LGDLYEEEMoxRELR(R) }

  ================
 *K2C7_HUMAN*
  accession n: P08729

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LPDIFEAQIAGLR(G);; $m/Z=(R)EVTINQSLLAPLR(L);; $m/Z=(K)VDALNDEINFLR(T) }

  ================
 *NUCL_HUMAN*
  accession n: P19338

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GYAFIEFASFEDAK(E);; $m/Z=(K)TLVLSNLSYSATEETLQEVFEK(A) }

  ================
 *PTBP1_HUMAN*
  accession n: P26599

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)IAIPGLAGAGNSVLLVSNLNPER(V);; $m/Z=(K)NFQNIFPPSATLHLSNIPPSVSEEDLK(V) }

  ================
 *IMA2_HUMAN*
  accession n: P52292

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)NVSSFPDDATSPLQENR(N);; $m/Z=(K)LLGASELPIVTPALR(A) }

  ================
 *TBA1B_HUMAN*
  accession n: P68363

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AVFVDLEPTVIDEVR(T) }

  ================
 *RRMJ3_HUMAN*
  accession n: Q8IY81

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ILDPEGLALGAVIASSK(K) }

  ================
 *GRWD1_HUMAN*
  accession n: Q9BQ67

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LLQVVEEPQALAAFLR(D);; $m/Z=(R)AQTGAPCLSFDIVR(D);; $m/Z=(R)REPFLLSGGDDGALK(I) }

  ================
 *REXO4_HUMAN*
  accession n: Q9GZR2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TAVSGIRPENLK(Q);; $m/Z=(K)QLGQSEGSVSLSLVK(E) }

  ================
 *RCC2_HUMAN*
  accession n: Q9P258

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GQLLIFGATNWDLIGR(K) }

  ================
 *PRP19_HUMAN*
  accession n: Q9UMS4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)IWSVPNASCVQVVR(A);; $m/Z=(K)TVPEELVKPEELSK(Y);; $m/Z=(R)QVASHVGLHSASIPGILALDLCPSDTNK(I);; $m/Z=(K)TLQLDNNFEVK(S) }
[Click to access protein entry]
 Spot: 1D-001V7W (nucleoli_hela_1d_human)
 pI: N\A Mw: 105656
 %vol: 1.6129   %od: 1.79503
 ================
 *MPP10_HUMAN*
  accession n°: O00566

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LSLAEIYEQEYIK(L) }

  ================
 *SK2L2_HUMAN*
  accession n: P42285

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)IVIPNEESVVIYYK(I);; $m/Z=(R)IEESITEDLSLADLMoxPR(V);; $m/Z=(R)IEESITEDLSLADLMPR(V);; $m/Z=(K)EYPFILDAFQR(E);; $m/Z=(K)LDFNTDEEKK(M);; $m/Z=(K)ETIEILFSEGLIK(A);; $m/Z=(R)DVDFEGTDEPIFGK(K);; $m/Z=(R)RLEELLR(Q);; $m/Z=(K)FAEGITKIK(R) }

  ================
 *NOP2_HUMAN*
  accession n: P46087

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LVPTGLDFGQEGFTR(F);; $m/Z=(R)IQDIVGILR(D);; $m/Z=(R)GVNLDPLGK(W);; $m/Z=(K)NTGVILANDANAER(L);; $m/Z=(K)ELLLSAIDSVNATSK(T) }

  ================
 *DDX10_HUMAN*
  accession n: Q13206

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LPIPEYALSLGLAVAPR(V);; $m/Z=(K)NHDFSAGLIIGGK(D);; $m/Z=(R)FLQKMQK(Q);; $m/Z=(R)INNINILVCTPGR(L) }

  ================
 *NOG2_HUMAN*
  accession n: Q13823

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)DPMoxGTRSPHIETYLK(K);; $m/Z=(K)VIDSSDVVVQVLDAR(D);; $m/Z=(R)SPHIETYLK(K) }

  ================
 *PWP2_HUMAN*
  accession n: Q15269

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VLFDPFELDTSVTPGR(V) }

  ================
 *UT14A_HUMAN*
  accession n: Q9BVJ6

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LAESLLALSQQEELADLPK(D);; $m/Z=(K)DSGSQEVLSELR(V);; $m/Z=(K)LVLADLLEPVK(T);; $m/Z=(K)VSEFNVSSEGSGEK(L) }

  ================
 *DDX24_HUMAN*
  accession n: Q9GZR7

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AEAESDALPDDTVIESEALPSDIAAEAR(A);; $m/Z=(R)RPEIVVATPGR(L);; $m/Z=(R)ATNEGLSLMLIGPEDVINFK(K);; $m/Z=(R)ALSFLGFSAPTPIQALTLAPAIR(D);; $m/Z=(K)TAILVGGMSTQK(Q);; $m/Z=(K)TGGTVSDQALLFGDDDAGEGPSSLIR(E);; $m/Z=(R)NEATVETLTETK(I);; $m/Z=(K)KDEDIPLFPVQTK(Y) }

  ================
 *NAT10_HUMAN*
  accession n: Q9H0A0

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)SMDLSEYIIR(G);; $m/Z=(R)GDDEEWNEVLNK(A);; $m/Z=(K)SMoxDLSEYIIR(G);; $m/Z=(K)LKSMoxDLSEYIIR(G);; $m/Z=(K)LFNEVQEK(A);; $m/Z=(K)EIELPSGQLMoxGLFNR(I);; $m/Z=(R)KDLPPLLLK(L);; $m/Z=(R)FPCLEEK(V);; $m/Z=(R)ALQLLQMoxYYEGR(F);; $m/Z=(R)IAVHPDYQGMoxGYGSR(A);; $m/Z=(K)ASGDLIPWTVSEQFQDPDFGGLSGGR(V);; $m/Z=(K)WLNDLLCLDCLNITR(I);; $m/Z=(R)TLHEVSLQESIR(Y);; $m/Z=(K)ESLQDTQPVGVLVDCCK(T);; $m/Z=(K)ELGFSSHRK(K);; $m/Z=(K)ELGFSSHR(K);; $m/Z=(R)ILIENGVAER(Q) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 949.5 (0), 991.6 (0), 1021.6 (0), 1226.6 (0), 1411.8 (0),
  1484.8 (0), 1604.9 (0), 1655 (0), 1919 (0), 2019 (0), 2159.3 (0),
  2876.5 (0) }

  ================
 *XRN2_HUMAN*
  accession n: Q9H0D6

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)NSPGSQVASNPR(Q);; $m/Z=(K)YAWQGVALLPFVDER(R) }

  ================
 *NOL6_HUMAN*
  accession n: Q9H6R4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TVFRPPLDIYDVLIR(L);; $m/Z=(R)QAVDSPAASFCR(G) }

  ================
 *RPA2_HUMAN*
  accession n: Q9H9Y6

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)HLTDPSYGIPR(E);; $m/Z=(K)TGLGLLQDSGLCVVADK(L) }

  ================
 *RBM28_HUMAN*
  accession n: Q9NW13

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DTQSVSAIGEEK(S);; $m/Z=(R)SEQLEELFSQVGPVK(Q);; $m/Z=(R)LCLHNLPK(A);; $m/Z=(K)GQSLGYAFAEFQEHEHALK(A);; $m/Z=(K)AEVEQVELPDGK(K) }

  ================
 *RRP44_HUMAN*
  accession n: Q9Y2L1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)NVIVLQTVLQEVR(N) }

  ================
 *RBM19_HUMAN*
  accession n: Q9Y4C8

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)YGPLSELHYPIDSLTK(K);; $m/Z=(R)VALGETQLVQEVR(R) }
[Click to access protein entry]
 Spot: 1D-001VA0 (nucleoli_hela_1d_human)
 pI: N\A Mw: 22406
 %vol: 0.566483   %od: 0.560375
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L) }

  ================
 *RL21_HUMAN*
  accession n: P46778

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VYNVTQHAVGIVVNK(Q) }

  ================
 *SRSF7_HUMAN*
  accession n: P99058

   Identification Methods:
  * MAPPING: {PMF}

  ================
 *RL18A_HUMAN*
  accession n: Q02543

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)DLTTAGAVTQCYR(D);; $m/Z=(K)SSGEIVYCGQVFEK(S) }

  ================
 *RLP24_HUMAN*
  accession n: Q9UHA3

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ELTVDNSFEFEK(R);; $m/Z=(K)MoxVQQLQEDVDMoxEDAP(-) }
[Click to access protein entry]
 Spot: 1D-001VAG (nucleoli_hela_1d_human)
 pI: N\A Mw: 16579
 %vol: 0.479938   %od: 0.431397
 ================
 *RL35A_HUMAN*
  accession n°: P18077

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)DETEFYLGKR(C) }

  ================
 *RS15A_HUMAN*
  accession n: P62244

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)QFGFIVLTTSAGIMoxDHEEAR(R);; $m/Z=(K)HGYIGEFEIIDDHR(A) }

  ================
 *RL30_HUMAN*
  accession n: P62888

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LVILANNCPALR(K);; $m/Z=(R)VCTLAIIDPGDSDIIR(S);; $m/Z=(K)TGVHHYSGNNIELGTACGK(Y);; $m/Z=(R)KSEIEYYAMLAK(T) }
[Click to access protein entry]
 Spot: 1D-001V9K (nucleoli_hela_1d_human)
 pI: N\A Mw: 29716
 %vol: 0.456334   %od: 0.42662
 ================
 *RL10A_HUMAN*
  accession n°: P62906

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)KYDAFLASESLIK(Q) }
[Click to access protein entry]
 Spot: 1D-001V9V (nucleoli_hela_1d_human)
 pI: N\A Mw: 24539
 %vol: 0.464202   %od: 0.465938
 ================
 *RL9_HUMAN*
  accession n°: P32969

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TILSNQTVDIPENVDITLK(G);; $m/Z=(R)TVIVK(G) }
[Click to access protein entry]
 Spot: 1D-001V88 (nucleoli_hela_1d_human)
 pI: N\A Mw: 70605
 %vol: 0.889064   %od: 0.980017
 ================
 *NOP56_HUMAN*
  accession n°: O00567

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)LLLETHLPSK(K) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 918.5 (0), 952.5 (0), 1017.5 (0), 1188.6 (0), 1239.6 (0),
  1311.7 (0), 1439.8 (0), 1857 (0), 1872 (0), 2575.4 (0)
  }
[Click to access protein entry]
 Spot: 1D-001V97 (nucleoli_hela_1d_human)
 pI: N\A Mw: 34821
 %vol: 0.810386   %od: 0.807308
 ================
 *ROA1_HUMAN*
  accession n°: P09651

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)IEVIEIMoxTDR(G);; $m/Z=(K)LFIGGLSFETTDESLR(S);; $m/Z=(R)KLFIGGLSFETTDESLR(S);; $m/Z=(K)SESPKEPEQLR(K) }

  ================
 *ROA0_HUMAN*
  accession n: Q13151

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LFIGGLNVQTSESGLR(G) }
[Click to access protein entry]
 Spot: 1D-001V87 (nucleoli_hela_1d_human)
 pI: N\A Mw: 73806
 %vol: 1.25885   %od: 1.31514
 ================
 *NOP56_HUMAN*
  accession n°: O00567

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)MoxSQVAPSLSALIGEAVGAR(L);; $m/Z=(R)IDCFSEVPTSVFGEK(L);; $m/Z=(K)EVEEISLLQPQVEESVLNLGK(F);; $m/Z=(K)MSQVAPSLSALIGEAVGAR(L) }

  ================
 *S10A8_HUMAN*
  accession n: P05109

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LLETECPQYIR(K);; $m/Z=(K)ALNSIIDVYHK(Y) }

  ================
 *S10A9_HUMAN*
  accession n: P06702

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)QLSFEEFIMLMAR(L);; $m/Z=(K)VIEHIMEDLDTNADK(Q);; $m/Z=(K)LGHPDTLNQGEFK(E);; $m/Z=(R)NIETIINTFHQYSVK(L) }

  ================
 *NUCL_HUMAN*
  accession n: P19338

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GFGFVDFNSEEDAK(E);; $m/Z=(K)GYAFIEFASFEDAK(E) }

  ================
 *SPB3_HUMAN*
  accession n: P29508

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DLSMIVLLPNEIDGLQK(L);; $m/Z=(K)FYQTSVESVDFANAPEESR(K);; $m/Z=(K)TYLFLQEYLDAIK(K);; $m/Z=(K)FMFDLFQQFR(K) }

  ================
 *S10AB_HUMAN*
  accession n: P31949

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TEFLSFMNTELAAFTK(N) }

  ================
 *ACTB_HUMAN*
  accession n: P60709

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SYELPDGQVITIGNER(F);; $m/Z=(K)QEYDESGPSIVHR(K) }

  ================
 *FABP5_HUMAN*
  accession n: Q01469

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LVVECVMNNVTCTR(I) }

  ================
 *CIR1A_HUMAN*
  accession n: Q969X6

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TLLYNPFPPTNESDVIR(R);; $m/Z=(K)VQFWDSATGTLVK(S);; $m/Z=(K)IYKPLLFMoxDLLDER(T);; $m/Z=(R)SALQILFSEDSTK(L) }

  ================
 *DDX21_HUMAN*
  accession n: Q9NR30

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)NEEPSEEEIDAPKPKK(M);; $m/Z=(K)EGAFSNFPISEETIK(L) }
[Click to access protein entry]
 Spot: 1D-001V8R (nucleoli_hela_1d_human)
 pI: N\A Mw: 45729
 %vol: 0.86546   %od: 0.912401
 ================
 *PK1IP_HUMAN*
  accession n°: Q9NWT1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)FLSESVLAVAGDEEVIR(F);; $m/Z=(R)FFDCDSLVCLCEFK(A) }

  ================
 *LYAR_HUMAN*
  accession n: Q9NX58

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VLAQYYTVTDEHHR(S);; $m/Z=(R)SEEELLVIFNK(K);; $m/Z=(M)VFFTCNACGESVK(K);; $m/Z=(R)NCECLSCIDCGK(D);; $m/Z=(R)ELLEQISAFDNVPR(K);; $m/Z=(K)GQEADLEAGGEEVPEANGSAGK(R) }

  ================
 *PA2G4_HUMAN*
  accession n: Q9UQ80

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ITSGPFEPDLYK(S);; $m/Z=(R)LVKPGNQNTQVTEAWNK(V) }
[Click to access protein entry]
 Spot: 1D-001V94 (nucleoli_hela_1d_human)
 pI: N\A Mw: 37156
 %vol: 0.896932   %od: 0.931509
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L) }

  ================
 *FBRL_HUMAN*
  accession n: P22087

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LAAAILGGVDQIHIKPGAK(V) }

  ================
 *EXOS7_HUMAN*
  accession n: Q15024

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VYIVHGVQEDLR(V) }
[Click to access protein entry]
 Spot: 1D-001V9M (nucleoli_hela_1d_human)
 pI: N\A Mw: 28764
 %vol: 0.660898   %od: 0.67539
 ================
 *RL14_HUMAN*
  accession n°: P50914

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VAYVSFGPHAGK(L);; $m/Z=(K)LVAIVDVIDQNR(A) }
[Click to access protein entry]
 Spot: 1D-001V8C (nucleoli_hela_1d_human)
 pI: N\A Mw: 63488
 %vol: 1.03855   %od: 1.07775
 ================
 *RL1D1_HUMAN*
  accession n°: O76021

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TVSQIISLQTLK(K);; $m/Z=(K)LPEKWESVK(L);; $m/Z=(R)RLLPSLIGR(H);; $m/Z=(R)LLSSFDFFLTDAR(I);; $m/Z=(K)DEPNSTPEKTEQFYR(K);; $m/Z=(R)KNNYGLLLNENESLFLMVVLWK(I);; $m/Z=(K)AVDALLTHCK(S);; $m/Z=(R)KAVDALLTHCK(S) }

  ================
 *LMNA_HUMAN*
  accession n: P02545

   Identification Methods:
  * MAPPING: {PMF}

  ================
 *NUCL_HUMAN*
  accession n: P19338

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GFGFVDFNSEEDAK(E);; $m/Z=(K)FGYVDFESAEDLEK(A) }

  ================
 *HNRPK_HUMAN*
  accession n: P61978

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)GSYGDLGGPIITTQVTIPK(D) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 954.5 (0), 1053.6 (0), 1089.5 (0), 1098.5 (0), 1106.5 (0),
  1126.6 (0), 1194.7 (0), 1492.8 (0), 1780.8 (0) }

  ================
 *UTP6_HUMAN*
  accession n: Q9NYH9

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VFSAMoxLAIHSNKPALWIMoxAAKWEMEDR(L);; $m/Z=(K)MLQGESAEAFVAK(H);; $m/Z=(K)SLQESRPFSVDFFR(K);; $m/Z=(R)EALEVAVAGTELFR(D);; $m/Z=(R)ELEIESQTEEQPTTK(Q);; $m/Z=(K)ASMoxDVENPDYSEEILK(G);; $m/Z=(K)ASMDVENPDYSEEILK(G) }

  ================
 *DDX52_HUMAN*
  accession n: Q9Y2R4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AITFFTEDDKPLLR(S);; $m/Z=(K)KFDILVTTPNR(L) }
[Click to access protein entry]
 Spot: 1D-001VAK (nucleoli_hela_1d_human)
 pI: N\A Mw: 15398
 %vol: 0.377655   %od: 0.368929
 ================
 *H4_HUMAN*
  accession n°: P62805

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)ISGLIYEETR(G);; $m/Z=(K)RISGLIYEETR(G);; $m/Z=(R)DNIQGITKPAIR(R);; $m/Z=(K)VFLENVIR(D) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 989.6 (0), 1134.5 (0), 1180.6 (0), 1325.8 (0), 1336.7 (0)
  }
[Click to access protein entry]
 Spot: 1D-001V9F (nucleoli_hela_1d_human)
 pI: N\A Mw: 31824
 %vol: 0.409127   %od: 0.434704
 ================
 *RS4X_HUMAN*
  accession n°: P62701

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1167.7 (0), 1215.7 (0), 1273.7 (0), 1506.8 (0), 1542.9 (0),
  1782.8 (0), 1798.8 (0), 2255.1 (0) }
[Click to access protein entry]
 Spot: 1D-001VAC (nucleoli_hela_1d_human)
 pI: N\A Mw: 18078
 %vol: 1.16444   %od: 1.30853
 ================
 *RL22_HUMAN*
  accession n°: P35268

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ITVTSEVPFSK(R);; $m/Z=(R)YFQINQDEEEEEDED(-);; $m/Z=(K)AGNLGGGVVTIER(S) }

  ================
 *RS14_HUMAN*
  accession n: P62263

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)IEDVTPIPSDSTR(R) }

  ================
 *RL31_HUMAN*
  accession n: P62899

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LYTLVTYVPVTTFK(N) }

  ================
 *H2B1L_HUMAN*
  accession n: P99060

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AMoxGIMoxNSFVNDIFER(I);; $m/Z=(K)AMGIMNSFVNDIFER(I) }

  ================
 *H33_SPISO*
  accession n: P99061

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)STELLIR(K);; $m/Z=(R)EIAQDFK(T);; $m/Z=(R)YRPGTVALR(E) }
[Click to access protein entry]
 Spot: 1D-001V81 (nucleoli_hela_1d_human)
 pI: N\A Mw: 85677
 %vol: 1.73092   %od: 1.47241
 ================
 *DHX15_HUMAN*
  accession n°: O43143

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)HQSFVLVGETGSGK(T);; $m/Z=(R)YGVIILDEAHER(T);; $m/Z=(R)EVDDLGPEVGDIK(I);; $m/Z=(R)TLATDILMGVLK(E);; $m/Z=(K)TEMQDNTYPEILR(S);; $m/Z=(R)TLATDILMoxGVLK(E);; $m/Z=(K)FQIYFDNCPLLTIPGR(T);; $m/Z=(R)ASTNAMoxLISAGLPPLK(A);; $m/Z=(K)IIPLYSTLPPQQQQR(I);; $m/Z=(R)IRVESLLVTAISK(A) }

  ================
 *NUCL_HUMAN*
  accession n: P19338

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GFGFVDFNSEEDAK(E);; $m/Z=(K)GYAFIEFASFEDAK(E) }

  ================
 *TBL3_HUMAN*
  accession n: Q12788

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)QFAGYSEEVLDVR(F);; $m/Z=(K)ESFLVTGSQDCTVK(L);; $m/Z=(R)GTQLLSSGSDGLVK(L);; $m/Z=(R)TVPVFESVEAAVLLPEEPVSQLGVK(S) }

  ================
 *ILF3_HUMAN*
  accession n: Q12906

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VLAGETLSVNDPPDVLDR(Q) }

  ================
 *NOL9_HUMAN*
  accession n: Q5SY16

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LAAFADALEFADEEK(E) }

  ================
 *DDX21_HUMAN*
  accession n: Q9NR30

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)NEEPSEEEIDAPKPKK(M);; $m/Z=(K)EEYQLVQVEQK(A);; $m/Z=(R)GLDIPEVDLVIQSSPPK(D);; $m/Z=(K)EGAFSNFPISEETIK(L) }
[Click to access protein entry]
 Spot: 1D-001V7X (nucleoli_hela_1d_human)
 pI: N\A Mw: 101482
 %vol: 1.47128   %od: 1.58816
 ================
 *MPP10_HUMAN*
  accession n°: O00566

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)MoxAPVITEETTLQLEDIIK(Q) }

  ================
 *PARP1_HUMAN*
  accession n: P09874

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VFSATLGLVDIVK(G) }

  ================
 *SFPQ_HUMAN*
  accession n: P23246

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LFVGNLPADITEDEFK(R);; $m/Z=(R)LFVGNLPADITEDEFKR(L) }

  ================
 *NOP2_HUMAN*
  accession n: P46087

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LVPTGLDFGQEGFTR(F);; $m/Z=(K)ELLLSAIDSVNATSK(T) }

  ================
 *BOP1_HUMAN*
  accession n: Q14137

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VNVDPEDLIPK(L);; $m/Z=(R)LVAGSTDQLLSAFVPPEEPPLQPAR(W);; $m/Z=(R)DLQPFPTCQALVYR(G) }

  ================
 *PWP2_HUMAN*
  accession n: Q15269

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VLFDPFELDTSVTPGR(V) }

  ================
 *NOC3L_HUMAN*
  accession n: Q8WTT2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)YSSEVATESPLDFTK(Y);; $m/Z=(K)FLQGDSFLNEDLNQLIK(R);; $m/Z=(R)SPLLPAVLEGLAK(F) }
[Click to access protein entry]
 Spot: 1D-001V84 (nucleoli_hela_1d_human)
 pI: N\A Mw: 78406
 %vol: 1.03855   %od: 0.981116
 ================
 *DDX3X_HUMAN*
  accession n°: O00571

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SPILVATAVAAR(G) }

  ================
 *PARN_HUMAN*
  accession n: O95453

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)SQANGAGALSYVSPNTSK(C);; $m/Z=(K)DIINNTSLAELEK(R);; $m/Z=(R)NGIPYLNQEEER(Q);; $m/Z=(R)VMoxDIPYLNLEGPDLQPK(R) }

  ================
 *WDR43_HUMAN*
  accession n: Q15061

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LILLITQVTASEK(T) }

  ================
 *NOL10_HUMAN*
  accession n: Q9BSC4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)YIEFHSQSGFYYK(T);; $m/Z=(K)MoxGIYYIPVLGPAPR(W);; $m/Z=(K)SLPNILTDDRFK(V) }

  ================
 *DDX31_HUMAN*
  accession n: Q9H8H2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)SDGPYALVLVPTR(E);; $m/Z=(K)DITVILNAVNAECQK(R);; $m/Z=(K)SHAVGPQEIRER(A);; $m/Z=(R)TAVFQEFSHSR(R) }

  ================
 *DDX18_HUMAN*
  accession n: Q9NVP1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)NLQCLVIDEADR(I);; $m/Z=(K)LGNGINIIVATPGR(L) }
[Click to access protein entry]
 Spot: 1D-001VA8 (nucleoli_hela_1d_human)
 pI: N\A Mw: 19520
 %vol: 0.676633   %od: 0.55964
 ================
 *SRP14_HUMAN*
  accession n°: P37108

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(M)VLLESEQFLTELTR(L) }
[Click to access protein entry]
 Spot: 1D-001V89 (nucleoli_hela_1d_human)
 pI: N\A Mw: 68364
 %vol: 1.47128   %od: 1.64622
 ================
 *PESC_HUMAN*
  accession n°: O00541

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)LYQLLNLHYPPK(L);; $m/Z=(K)AGEGTYALDSESCMoxEK(L);; $m/Z=(K)SLCIGATYDVTDSR(I);; $m/Z=(R)FLLHEPIVNK(F) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 932.7 (0), 940.6 (0), 1062.7 (0), 1095.7 (0), 1209.8 (0),
  1380.9 (0), 1557.9 (0), 1736.1 (0), 1920.2 (0), 2005.3 (0), 3108.8 (0)
  }

  ================
 *NOP56_HUMAN*
  accession n: O00567

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)YPASTVQILGAEK(A);; $m/Z=(K)AQLGLGHSYSR(A);; $m/Z=(R)EWYGYHFPELVK(I);; $m/Z=(R)LAQFIGNR(R);; $m/Z=(R)SSMoxGMoxDISAIDLINIESFSSR(V);; $m/Z=(K)MoxSQVAPSLSALIGEAVGAR(L);; $m/Z=(K)MSQVAPSLSALIGEAVGAR(L);; $m/Z=(R)LIAHAGSLTNLAK(Y);; $m/Z=(R)IDCFSEVPTSVFGEK(L);; $m/Z=(K)EVEEISLLQPQVEESVLNLGK(F);; $m/Z=(R)LVAFCPFASSQVALENANAVSEGVVHEDLR(L);; $m/Z=(R)LLLETHLPSK(K);; $m/Z=(R)LHFHNLVK(G) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 918.5 (0), 952.5 (0), 1007.6 (0), 1017.5 (0), 1188.6 (0),
  1239.6 (0), 1311.7 (0), 1376.7 (0), 1822.9 (0), 1857 (0), 1873 (0),
  2353.3 (0), 2575.4 (0), 3229.6 (0) }

  ================
 *RL1D1_HUMAN*
  accession n: O76021

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TVSQIISLQTLK(K);; $m/Z=(R)LLSSFDFFLTDAR(I) }

  ================
 *XRCC6_HUMAN*
  accession n: P12956

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)DIISIAEDEDLR(V);; $m/Z=(R)NIPPYFVALVPQEEELDDQK(I);; $m/Z=(R)SDSFENPVLQQHFR(N);; $m/Z=(K)NIYVLQELDNPGAK(R) }

  ================
 *K0020_HUMAN*
  accession n: Q15397

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GAIILSSLLQSCDLEVANK(V);; $m/Z=(R)HAEASAIVEYAYNDK(A);; $m/Z=(K)QAFEELRDDLVELSK(A) }
[Click to access protein entry]
 Spot: 1D-001V8E (nucleoli_hela_1d_human)
 pI: N\A Mw: 60781
 %vol: 1.06216   %od: 0.838542
 ================
 *RRP8_HUMAN*
  accession n°: O43159

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)NPVHCFDLASLDPR(V);; $m/Z=(R)YLNEQLYSGPSSAAQR(L);; $m/Z=(K)FQPPQVPDQAPAEAPTEK(T) }
[Click to access protein entry]
 Spot: 1D-001V96 (nucleoli_hela_1d_human)
 pI: N\A Mw: 35286
 %vol: 0.574352   %od: 0.560375
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(K)VDNDENEHQLSLR(T) }

  ================
 *ROA1_HUMAN*
  accession n: P09651

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GFAFVTFDDHDSVDK(I);; $m/Z=(K)LFIGGLSFETTDESLR(S);; $m/Z=(R)KLFIGGLSFETTDESLR(S) }

  ================
 *ROA0_HUMAN*
  accession n: Q13151

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LFIGGLNVQTSESGLR(G) }

  ================
 *EXOS8_HUMAN*
  accession n: Q96B26

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TTTVNIGSISTADGSALVK(L) }

  ================
 *DIM1_HUMAN*
  accession n: Q9UNQ2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)IQQILTSTGFSDKR(A);; $m/Z=(R)LLHGFNAEGIHFS(-) }
[Click to access protein entry]
 Spot: 1D-001V8T (nucleoli_hela_1d_human)
 pI: N\A Mw: 43891
 %vol: 0.731707   %od: 0.743737
 ================
 *HNRPG_HUMAN*
  accession n°: P38159

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GFAFVTFESPADAK(D);; $m/Z=(R)GGHMoxDDGGYSMoxNFNMSSSR(G);; $m/Z=(K)VEQATKPSFESGR(R) }

  ================
 *ACTG_HUMAN*
  accession n: P63261

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VAPEEHPVLLTEAPLNPK(A);; $m/Z=(K)SYELPDGQVITIGNER(F) }

  ================
 *ILF2_HUMAN*
  accession n: Q12905

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VKPAPDETSFSEALLK(R);; $m/Z=(K)ILITTVPPNLR(K);; $m/Z=(K)ILPTLEAVAALGNK(V) }

  ================
 *RRS1_HUMAN*
  accession n: Q15050

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ELELQFDLGNLLASDRNPPTGLR(C);; $m/Z=(R)DNTQLLINQLWQLPTER(V);; $m/Z=(K)TNLVWDEVSGQWR(R);; $m/Z=(R)KFQPLFGDFAAEK(K);; $m/Z=(K)FQPLFGDFAAEK(K);; $m/Z=(K)EWLIEVPGNADPLEDQFAK(R);; $m/Z=(K)ELELQFDLGNLLASDR(N) }

  ================
 *WDR74_HUMAN*
  accession n: Q6RFH5

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VPIWDQDIQFLPGSQK(L);; $m/Z=(K)LSGLEQPQGALQTR(R) }

  ================
 *Q9UG11*
  accession n: Q9UG11

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TEEAILISLAALQPGLIQAGAR(H);; $m/Z=(R)GSDVASAQLPNFR(H) }

  ================
 *NOL7_HUMAN*
  accession n: Q9UMY1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AAVQFLNNAWGIQK(K);; $m/Z=(R)KLLPDTILEK(L) }
[Click to access protein entry]
 Spot: 1D-001V7Z (nucleoli_hela_1d_human)
 pI: N\A Mw: 90286
 %vol: 1.5657   %od: 1.75646
 ================
 *NVL_HUMAN*
  accession n°: O15381

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ALGLVTPAGVLLAGPPGCGK(T) }

  ================
 *NUCL_HUMAN*
  accession n: P19338

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GYAFIEFASFEDAK(E);; $m/Z=(K)SKGYAFIEFASFEDAK(E);; $m/Z=(K)NDLAVVDVR(I);; $m/Z=(K)FGYVDFESAEDLEK(A);; $m/Z=(K)GFGFVDFNSEEDAK(E);; $m/Z=(K)GLSEDTTEETLK(E) }

  ================
 *RRP1B_HUMAN*
  accession n: Q14684

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)FHFIDIYLDELSK(V);; $m/Z=(R)LDKYYMLIR(L) }

  ================
 *DDX27_HUMAN*
  accession n: Q96GQ7

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)FKDEQIDILVATDVAAR(G);; $m/Z=(R)SADFNPDFVFTEK(E);; $m/Z=(R)ELGIQVHSVTR(Q);; $m/Z=(R)SVSLVGEDERK(M);; $m/Z=(R)IFVNSNTDVAPFLR(Q) }

  ================
 *DDX21_HUMAN*
  accession n: Q9NR30

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)EGAFSNFPISEETIK(L);; $m/Z=(K)LGVCFDVPTASVTEIQEK(W);; $m/Z=(K)ELKEQLGEEIDSK(V);; $m/Z=(K)GAVEALAAALAHISGATSVDQR(S);; $m/Z=(R)IGVPSATEIIK(A);; $m/Z=(K)RIGVPSATEIIK(A);; $m/Z=(K)EEYQLVQVEQK(A);; $m/Z=(R)TGVCICFYQHK(E);; $m/Z=(R)GLDIPEVDLVIQSSPPKDVESYIHR(S);; $m/Z=(R)GLDIPEVDLVIQSSPPK(D);; $m/Z=(K)QDAQSLHGDIPQK(Q);; $m/Z=(K)EAQELSQNSAIK(Q);; $m/Z=(K)TAITVEHLAIK(C);; $m/Z=(K)STYEQVDLIGK(K);; $m/Z=(R)NGIDILVGTPGR(I);; $m/Z=(K)DFSDITKK(L);; $m/Z=(R)APQVLVLAPTR(E);; $m/Z=(K)TFSFAIPLIEK(L);; $m/Z=(K)TFHHVYSGK(D) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 903.4 (0), 967.5 (0), 1018.5 (0), 1164.7 (0), 1220.7 (0),
  1252.6 (0), 1265.7 (0), 1377.8 (0), 1380.7 (0), 1392.7 (0), 1475.8 (0),
  1524.8 (0), 1668.8 (0), 1807 (0), 1839.9 (0), 1993 (0), 1996 (0),
  2007.1 (0), 2008.9 (0), 2108.1 (0), 2137 (0), 2806.5 (0)
  }

  ================
 *TEX10_HUMAN*
  accession n: Q9NXF1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VLDILLEQYPALITGR(S);; $m/Z=(R)VGPEELPVVGQLLR(L);; $m/Z=(R)LAAVQLLQFLAPK(I) }

  ================
 *AATF_HUMAN*
  accession n: Q9NY61

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ALLTTNQLPQPDVFPLFK(D);; $m/Z=(R)SLVGLQEELLFQYPDTR(Y) }

  ================
 *LAS1L_HUMAN*
  accession n: Q9Y4W2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ELLVSYEEEQFTVLEK(F) }
[Click to access protein entry]
 Spot: 1D-001VA2 (nucleoli_hela_1d_human)
 pI: N\A Mw: 21747
 %vol: 0.558614   %od: 0.421108
 ================
 *NIP7_HUMAN*
  accession n°: Q9Y221

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LHVTALDYLAPYAK(G) }
[Click to access protein entry]
 Spot: 1D-001V8L (nucleoli_hela_1d_human)
 pI: N\A Mw: 51716
 %vol: 1.29819   %od: 1.35923
 ================
 *RL4_HUMAN*
  accession n°: P36578

   Identification Methods:
  * MAPPING: {PMF}

  ================
 *RBM34_HUMAN*
  accession n: P42696

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LASLFSSLEPQIQPVYVPVPK(Q);; $m/Z=(K)ILDDTEDTVVSQR(K) }

  ================
 *Q9BSV5*
  accession n: Q9BSV5

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)IEEVPELPLVVEDK(V);; $m/Z=(R)IEEVPELPLVVEDKVEGYK(K) }

  ================
 *WDR12_HUMAN*
  accession n: Q9GZL7

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VFNCISYSPLCK(R);; $m/Z=(K)YAVDDVPFSIPAASEIADLSNIINK(L);; $m/Z=(K)HVEFDFLIK(G);; $m/Z=(K)SIMTIVGHTDVVK(D);; $m/Z=(K)WSPTHEQQLISGSLDNIVK(L);; $m/Z=(K)VLSVDWTDTGLLLSGGADNK(L) }

  ================
 *RPA49_HUMAN*
  accession n: Q9GZS1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LGTLSLPLPPAQTSDR(L);; $m/Z=(R)LSYVGNNFGTGALK(C);; $m/Z=(K)FEDLLSPAEYEALQSPSEAFR(N);; $m/Z=(K)SALGPGVPHIINTK(L) }

  ================
 *DDX47_HUMAN*
  accession n: Q9H0S4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ILNMDFETEVDK(I);; $m/Z=(R)NLGFTAIPLHGQMoxSQSK(R);; $m/Z=(K)LQQYYIFIPSK(F) }
[Click to access protein entry]
 Spot: 1D-001V7M (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 0.629425   %od: 0.649668
 ================
 *WDR75_HUMAN*
  accession n°: Q9H9V8

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ELSFVLDYINQSPK(C) }
[Click to access protein entry]
 Spot: 1D-001V8F (nucleoli_hela_1d_human)
 pI: N\A Mw: 59243
 %vol: 1.18804   %od: 1.2997
 ================
 *DKC1_HUMAN*
  accession n°: O60832

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)YEDGIEVNQEIVVITTK(G);; $m/Z=(K)SLPEEDVAEIQHAEEFLIKPESK(V);; $m/Z=(K)LDTSQWPLLLK(N);; $m/Z=(K)VTGCLIVCIER(A);; $m/Z=(R)LHNAIEGGTQLSR(A);; $m/Z=(K)QEYVDYSESAK(K) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 865.4 (0), 898.6 (0), 914.6 (0), 1003.6 (0), 1005.5 (0),
  1045.6 (0), 1052.5 (0), 1208.6 (0), 1224.6 (0), 1262.7 (0), 1313.8 (0),
  1319.7 (0), 1395.7 (0), 1815.9 (0), 2467.3 (0) }

  ================
 *NONO_HUMAN*
  accession n: Q15233

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)EQEIR(M);; $m/Z=(R)FAQPGSFEYEYAMR(W);; $m/Z=(R)FAQPGSFEYEYAMoxR(W);; $m/Z=(R)LFVGNLPPDITEEEMR(K) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 939.5 (0), 1016.5 (0), 1086.6 (0), 1102.6 (0), 1147.6 (0),
  1180.6 (0), 1196.6 (0), 1208.6 (0), 1228.6 (0), 1231.7 (0), 1540.8 (0),
  1695.7 (0), 1711.7 (0), 1859.9 (0), 1875.9 (0), 2163.1 (0)
  }
[Click to access protein entry]
 Spot: 1D-001V8W (nucleoli_hela_1d_human)
 pI: N\A Mw: 42121
 %vol: 0.936271   %od: 0.839277
 ================
 *ARP2_HUMAN*
  accession n°: P61160

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LALETTVLVESYTLPDGR(I);; $m/Z=(K)HIVLSGGSTMoxYPGLPSR(L);; $m/Z=(R)GYAFNHSADFETVR(M) }

  ================
 *ROAA_HUMAN*
  accession n: Q99729

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)IFVGGLNPEATEEK(I) }

  ================
 *EBP2_HUMAN*
  accession n: Q99848

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GLLKPGLNVVLEGPK(K);; $m/Z=(R)ESYDDVSSFR(A);; $m/Z=(K)RPTDYFAEMoxAK(S);; $m/Z=(K)LDFLEGDQKPLAQR(K);; $m/Z=(K)RPTDYFAEMAK(S);; $m/Z=(R)LDVTLGPVPEIGGSEAPAPQNK(D);; $m/Z=(R)GLLKPGLNVVLEGPKK(A);; $m/Z=(R)QAQAAVLAVLPR(L);; $m/Z=(K)AVDPEDDFQR(E) }

  ================
 *I20L2_HUMAN*
  accession n: Q9H9L3

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LVEVEWEEHLAR(N);; $m/Z=(K)VDLLGEFQSALPK(I);; $m/Z=(K)SGHSSVEDAQATMELYK(L) }
[Click to access protein entry]
 Spot: 1D-001V7S (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 1.33753   %od: 1.36805
 ================
 *NPA1P_HUMAN*
  accession n°: O60287

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ISTINILLSTLK(T);; $m/Z=(K)AQEGPDAEIIGGER(S);; $m/Z=(R)SHFTRPAGVSSAVIPVLR(K) }
[Click to access protein entry]
 Spot: 1D-001V8V (nucleoli_hela_1d_human)
 pI: N\A Mw: 42495
 %vol: 1.14083   %od: 1.20122
 ================
 *RPAC1_HUMAN*
  accession n°: O15160

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)LLPDITLLEPVEGEAAEELSR(C);; $m/Z=(R)ILLAEVPTMAVEK(V) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 975.6 (0), 1098.6 (0), 1201.7 (0), 1851.8 (0), 2084.1 (0),
  2294.2 (0), 3166.5 (0) }
[Click to access protein entry]
 Spot: 1D-001V85 (nucleoli_hela_1d_human)
 pI: N\A Mw: 76842
 %vol: 1.25885   %od: 1.33204
 ================
 *WDR43_HUMAN*
  accession n°: Q15061

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LILLITQVTASEK(T);; $m/Z=(K)STPKPIPILAAGFCSDK(M) }
[Click to access protein entry]
 Spot: 1D-001V98 (nucleoli_hela_1d_human)
 pI: N\A Mw: 34463
 %vol: 0.566483   %od: 0.604838
 ================
 *NSA2_HUMAN*
  accession n°: O95478

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GTVIEVNVSELGLVTQGGK(V) }
[Click to access protein entry]
 Spot: 1D-001VA1 (nucleoli_hela_1d_human)
 pI: N\A Mw: 22074
 %vol: 0.597954   %od: 0.61182
 ================
 *SRSF7_HUMAN*
  accession n°: P99058

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)NPPGFAFVEFEDPR(D) }
[Click to access protein entry]
 Spot: 1D-001V7Q (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 1.17231   %od: 1.05608
 ================
 *NPA1P_HUMAN*
  accession n°: O60287

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LLPPEDTQELIFK(D) }
[Click to access protein entry]
 Spot: 1D-001VAF (nucleoli_hela_1d_human)
 pI: N\A Mw: 16883
 %vol: 1.05429   %od: 1.14867
 ================
 *RL23_HUMAN*
  accession n°: P62829

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LPAAGVGDMoxVMoxATVK(K);; $m/Z=(R)LPAAGVGDMVMATVK(K);; $m/Z=(K)DGVFLYFEDNAGVIVNNK(G);; $m/Z=(R)ISLGLPVGAVINCADNTGAK(N) }

  ================
 *RL30_HUMAN*
  accession n: P62888

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LVILANNCPALR(K);; $m/Z=(R)VCTLAIIDPGDSDIIR(S) }

  ================
 *H2A1J_HUMAN*
  accession n: P99059

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AGLQFPVGR(V);; $m/Z=(K)VTIAQGGVLPNIQAVLLPK(K);; $m/Z=(R)HLQLAIR(N) }
[Click to access protein entry]
 Spot: 1D-001V93 (nucleoli_hela_1d_human)
 pI: N\A Mw: 37709
 %vol: 1.30606   %od: 1.41288
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)VDNDENEHQLSLR(T);; $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 931.5 (0), 974.5 (0), 1023.5 (0), 1568.7 (0), 2161 (0),
  2227.2 (0), 2243.2 (0), 2929.5 (0), 2945.5 (0) }
[Click to access protein entry]
 Spot: 1D-001V8X (nucleoli_hela_1d_human)
 pI: N\A Mw: 41811
 %vol: 1.24312   %od: 1.33756
 ================
 *RPAC1_HUMAN*
  accession n°: O15160

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ILLAEVPTMoxAVEK(V);; $m/Z=(R)NQGDEEGTEIDTLQFR(L);; $m/Z=(R)LLPDITLLEPVEGEAAEELSR(C) }

  ================
 *ARP2_HUMAN*
  accession n: P61160

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GYAFNHSADFETVR(M);; $m/Z=(K)LALETTVLVESYTLPDGR(I) }

  ================
 *EBP2_HUMAN*
  accession n: Q99848

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LDVTLGPVPEIGGSEAPAPQNK(D);; $m/Z=(R)QAQAAVLAVLPR(L);; $m/Z=(K)RPTDYFAEMAK(S);; $m/Z=(K)RPTDYFAEMoxAK(S);; $m/Z=(K)GFSDKLDFLEGDQKPLAQR(K);; $m/Z=(K)LDFLEGDQKPLAQR(K);; $m/Z=(R)ESYDDVSSFR(A);; $m/Z=(R)GLLKPGLNVVLEGPK(K);; $m/Z=(K)AVDPEDDFQR(E) }
[Click to access protein entry]
 Spot: 1D-001VAJ (nucleoli_hela_1d_human)
 pI: N\A Mw: 15701
 %vol: 0.424863   %od: 0.392446
 ================
 *NH2L1_HUMAN*
  accession n°: P55769

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LLDLVQQSCNYK(Q);; $m/Z=(K)KLLDLVQQSCNYK(Q);; $m/Z=(K)AYPLADAHLTK(K);; $m/Z=(K)QQIQSIQQSIER(L);; $m/Z=(R)ACGVSRPVIACSVTIK(E) }

  ================
 *H4_HUMAN*
  accession n: P62805

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ISGLIYEETR(G) }
[Click to access protein entry]
 Spot: 1D-001V8J (nucleoli_hela_1d_human)
 pI: N\A Mw: 53744
 %vol: 0.566483   %od: 0.576911
 ================
 *K2C8_HUMAN*
  accession n°: P05787

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ELQSQISDTSVVLSMoxDNSR(S);; $m/Z=(R)LEGLTDEINFLR(Q) }

  ================
 *RRP1_HUMAN*
  accession n: P56182

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AEPEAGEEQAGDDRDSGGPVLQFDYEAVANR(L);; $m/Z=(K)LQDLAGGIFPEDEIPEK(A);; $m/Z=(R)KLQDLAGGIFPEDEIPEK(A);; $m/Z=(R)VQLPPEIQLAQR(L);; $m/Z=(R)AAGGFTHDELLK(V);; $m/Z=(K)VGAEELTADQNLK(F) }
[Click to access protein entry]
 Spot: 1D-001VA6 (nucleoli_hela_1d_human)
 pI: N\A Mw: 20347
 %vol: 0.778913   %od: 0.817964
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VDNDENEHQLSLR(T);; $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(K)GQESFKK(Q) }

  ================
 *PPIB_HUMAN*
  accession n: P23284

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)DFMoxIQGGDFTR(G);; $m/Z=(K)HYGPGWVSMoxANAGK(D) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 860.4 (0), 1031.6 (0), 1244.7 (0), 1286.6 (0), 1302.6 (0),
  1364.7 (0) }

  ================
 *RL12_HUMAN*
  accession n: P30050

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)HSGNITFDEIVNIAR(Q);; $m/Z=(R)CTGGEVGATSALAPK(I);; $m/Z=(K)IGPLGLSPK(K);; $m/Z=(R)QAQIEVVPSASALIIK(A) }

  ================
 *RL11_HUMAN*
  accession n: P62913

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VLEQLTGQTPVFSK(A);; $m/Z=(R)KLCLNICVGESGDR(L) }
[Click to access protein entry]
 Spot: 1D-001V8G (nucleoli_hela_1d_human)
 pI: N\A Mw: 58189
 %vol: 1.26672   %od: 1.15419
 ================
 *U3IP2_HUMAN*
  accession n°: O43818

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)FSSSGDFLVAGVGQEHR(L);; $m/Z=(R)QLDLLCDIPLVGFINSLK(F);; $m/Z=(R)LWQCGEGFR(Q) }

  ================
 *VIME_HUMAN*
  accession n: P08670

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)KVESLQEEIAFLK(K);; $m/Z=(R)EEAENTLQSFR(Q);; $m/Z=(R)LGDLYEEEMoxRELR(R);; $m/Z=(R)LGDLYEEEMR(E);; $m/Z=(R)TNEKVELQELNDR(F);; $m/Z=(R)ISLPLPNFSSLNLR(E) }

  ================
 *UTP15_HUMAN*
  accession n: Q8TED0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)EISHVLNFLIR(N);; $m/Z=(K)EGTSVLEHTSDGFPENK(K) }
[Click to access protein entry]
 Spot: 1D-001V8U (nucleoli_hela_1d_human)
 pI: N\A Mw: 43110
 %vol: 1.04642   %od: 1.12737
 ================
 *RRS1_HUMAN*
  accession n°: Q15050

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)DNTQLLINQLWQLPTER(V);; $m/Z=(K)FQPLFGDFAAEK(K);; $m/Z=(K)EWLIEVPGNADPLEDQFAK(R);; $m/Z=(K)TNLVWDEVSGQWR(R) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 864.4 (0), 885.5 (0), 1204.5 (0), 1369.7 (0), 1497.8 (0),
  1583.8 (0), 1589.8 (0), 1832.9 (0), 2082.1 (0), 2171.1 (0),
  2327.17 (0), 2568.3 (0) }
[Click to access protein entry]
 Spot: 1D-001V9W (nucleoli_hela_1d_human)
 pI: N\A Mw: 24176
 %vol: 0.440598   %od: 0.440584
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L) }

  ================
 *UBC_HUMAN*
  accession n: P0CG48

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TITLEVEPSDTIENVK(A) }

  ================
 *RL9_HUMAN*
  accession n: P32969

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TILSNQTVDIPENVDITLK(G);; $m/Z=(R)DFNHINVELSLLGK(K) }

  ================
 *NOP16_HUMAN*
  accession n: Q9Y3C1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)KPYVLNDLEAEASLPEKK(G) }
[Click to access protein entry]
 Spot: 1D-001V7O (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 1.32966   %od: 1.13508
 ================
 *UTP20_HUMAN*
  accession n°: O75691

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)HENITTAATEIIGAICK(H);; $m/Z=(R)FETFQTITSYIK(E);; $m/Z=(R)HLDDINFDVR(F);; $m/Z=(R)FINNEYYPADLQVAPTQDLR(R);; $m/Z=(R)HDVVQTAVPDGPLQEVPLR(Y);; $m/Z=(K)NIQGTITGDILPR(L);; $m/Z=(K)YILDYPLGDK(L);; $m/Z=(R)ELNSTYSEQDPLLK(N) }

  ================
 *PRKDC_HUMAN*
  accession n: P78527

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)INQVFHGSCITEGNELTK(T);; $m/Z=(K)NLDLAVLELMoxQSSVDNTK(M);; $m/Z=(R)YNFPVEVEVPMER(K);; $m/Z=(K)CFGTGAAGNRTSPQEGER(Y);; $m/Z=(R)ATQQQHDFTLTQTADGR(S);; $m/Z=(R)STVLTPMFVETQASQGTLQTR(T);; $m/Z=(K)ETGLMoxYSIMoxVHALR(A);; $m/Z=(R)TVGALQVLGTEAQSSLLK(A);; $m/Z=(R)VVQMoxLGSLGGQINK(N);; $m/Z=(K)NLSSNEAISLEEIR(I);; $m/Z=(K)LLLQGEADQSLLTFIDK(A);; $m/Z=(R)CFFLSKIEEK(L);; $m/Z=(K)LVINTEEVFRPYAK(H);; $m/Z=(R)NELEIPGQYDGR(G);; $m/Z=(R)RILELSGSSSEDSEK(V);; $m/Z=(R)SQGCSEQVLTVLK(T);; $m/Z=(K)FYQGFLFSEKPEK(N) }

  ================
 *RRP5_HUMAN*
  accession n: Q14690

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TTEPGVTGLLLAVEGPAAK(R);; $m/Z=(K)VTPNEGLTVSFPFGK(I) }
[Click to access protein entry]
 Spot: 1D-001V7T (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 1.53422   %od: 1.51319
 ================
 *RPA1_HUMAN*
  accession n°: O95602

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AALNLPEAASYDEVR(G) }

  ================
 *RRP5_HUMAN*
  accession n: Q14690

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VTPNEGLTVSFPFGK(I);; $m/Z=(K)TTEPGVTGLLLAVEGPAAK(R) }

  ================
 *RRP12_HUMAN*
  accession n: Q5JTH9

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SEAPETPMEEEAELVLTEK(S);; $m/Z=(K)VAVTVMDVAHLAK(H);; $m/Z=(R)LSVLDLVVALAPCADEAAISK(L);; $m/Z=(K)VLDPASSDFTR(L);; $m/Z=(R)TYLTITDTQLVNSLLEK(A);; $m/Z=(K)EICAVLAAVTEVIR(S);; $m/Z=(K)SSGTFLSGLSDCTNVTFSK(V);; $m/Z=(K)SEAPETPMoxEEEAELVLTEK(S);; $m/Z=(K)DLLPCFPEGLVK(S);; $m/Z=(K)AMDLAQAGSTVESK(I);; $m/Z=(K)GRPDPYAYIPLNRSK(L);; $m/Z=(R)TLGMAISERPDLR(V);; $m/Z=(K)EGGGDEPLNFLDPK(V);; $m/Z=(K)HVQLVMEAIGK(L) }

  ================
 *RRMJ3_HUMAN*
  accession n: Q8IY81

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ILDPEGLALGAVIASSK(K);; $m/Z=(K)SDDDGFEIVPIEDPAK(H) }

  ================
 *MBB1A_HUMAN*
  accession n: Q9BQG0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AMoxFLQPDLDSLVDFSTNNQK(K);; $m/Z=(K)LLQALAQYQNHLQEQPR(K);; $m/Z=(R)KALVDILSEVSK(A);; $m/Z=(K)ALVDILSEVSK(A);; $m/Z=(K)ATLQEILPEVLK(A);; $m/Z=(K)KLVGSVNLFSDENVPR(L);; $m/Z=(K)LVGSVNLFSDENVPR(L);; $m/Z=(R)KLPAIALDLLR(L);; $m/Z=(K)EVVEQGLLK(M);; $m/Z=(R)LLGAALPLLTK(E);; $m/Z=(K)EQLHLVMoxQGDVIR(H);; $m/Z=(K)EQLHLVMQGDVIR(H);; $m/Z=(R)AMFLQPDLDSLVDFSTNNQK(K);; $m/Z=(K)HPFSFPLENQAR(E);; $m/Z=(R)SVFGHICSHLTPR(A);; $m/Z=(R)ALQLILDVLNPETSEDENDR(V);; $m/Z=(R)ALQLILDVLNPETSEDENDRVVVTDDSDER(R);; $m/Z=(R)VLDLVEVLVTK(Q);; $m/Z=(K)AGTDPSHMoxPTGPQAASCLDLNLVTR(V);; $m/Z=(R)VYSTALSSFLTK(R);; $m/Z=(R)HPVLCQSLLPILVQHITGPVRPR(H);; $m/Z=(K)AQHQQALSSLELLNVLFR(T) }
[Click to access protein entry]
 Spot: 1D-001VAH (nucleoli_hela_1d_human)
 pI: N\A Mw: 16327
 %vol: 0.448465   %od: 0.468878
 ================
 *RL35A_HUMAN*
  accession n°: P18077

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)DETEFYLGK(R) }

  ================
 *NH2L1_HUMAN*
  accession n: P55769

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)QQIQSIQQSIER(L) }
[Click to access protein entry]
 Spot: 1D-001V8A (nucleoli_hela_1d_human)
 pI: N\A Mw: 66828
 %vol: 1.51849   %od: 1.50328
 ================
 *RL1D1_HUMAN*
  accession n°: O76021

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SAALPIFSSFVSNWDEATK(R);; $m/Z=(K)LPEKWESVK(L);; $m/Z=(R)EINDCIGGTVLNISK(S);; $m/Z=(K)TVSQIISLQTLK(K);; $m/Z=(R)LLSSFDFFLTDAR(I);; $m/Z=(K)VPVSVNLLSK(N);; $m/Z=(K)KVPVSVNLLSK(N);; $m/Z=(R)RLLPSLIGR(H);; $m/Z=(K)DEPNSTPEKTEQFYR(K);; $m/Z=(R)SDSEDICLFTK(D);; $m/Z=(R)LTLPHSIR(S);; $m/Z=(K)SAALPIFSSFVSNWDEATKR(S) }

  ================
 *GNL3_HUMAN*
  accession n: Q9BVP2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LLGGFQETCSK(A);; $m/Z=(K)VIEASDVVLEVLDAR(D) }

  ================
 *GSCR2_HUMAN*
  accession n: Q9NZM5

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)YQAPDIDVQLSSELTDSLR(T);; $m/Z=(R)LAQEPLGLEVDQFLEDVR(L);; $m/Z=(R)TSGGLLSEAPNEK(L) }

  ================
 *NOP58_HUMAN*
  accession n: Q9Y2X3

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)HAASTVQILGAEK(A);; $m/Z=(R)YDAFGEDSSSAMoxGVENR(A);; $m/Z=(R)MMoxAIAPNVTVMoxVGELVGAR(L);; $m/Z=(K)LSELLPEEVEAEVK(A);; $m/Z=(K)FQDTAEALAAFTALMoxEGK(I);; $m/Z=(K)LNLSCIHSPVVNELMR(G);; $m/Z=(R)SQMoxDGLIPGVEPR(E);; $m/Z=(K)ELNNYIMoxRCR(E);; $m/Z=(R)LIAHAGSLLNLAK(H) }

  ================
 *UTP18_HUMAN*
  accession n: Q9Y5J1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)FVDEGSLYGLSIATSR(N);; $m/Z=(R)LVHLPSCTVFSNFPVIK(N);; $m/Z=(R)TGNFISTSTSLPR(G) }
[Click to access protein entry]
 Spot: 1D-001V7U (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 1.11723   %od: 1.17955
 ================
 *CEBPZ_HUMAN*
  accession n°: Q03701

   Identification Methods:
  * MAPPING: {MS/MS}

  ================
 *RRMJ3_HUMAN*
  accession n: Q8IY81

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ILDPEGLALGAVIASSK(K);; $m/Z=(K)GTEASSGTEAATGLEGEEK(D);; $m/Z=(K)TEIMoxSPLYQDEAPK(G) }
[Click to access protein entry]
 Spot: 1D-001V8D (nucleoli_hela_1d_human)
 pI: N\A Mw: 61882
 %vol: 1.24312   %od: 1.19645
 ================
 *HNRPK_HUMAN*
  accession n°: P61978

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GSYGDLGGPIITTQVTIPK(D) }

  ================
 *NOC4L_HUMAN*
  accession n: Q9BVI4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)REPTVSSFYVK(R);; $m/Z=(K)LVVGGLLSPEEDQSLLLSQFR(E);; $m/Z=(R)KLYGLLDPSVFHVK(Y);; $m/Z=(R)LGELLGHPSFQVK(E) }

  ================
 *SSF1_HUMAN*
  accession n: Q9NQ55

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LQDISELLATGAGLSESEAEPDGDHNITELPQAVAGR(G);; $m/Z=(R)NLEAYAANPHSFVFTR(G);; $m/Z=(K)DCVAVAGPLGVTHFLILSK(T) }

  ================
 *DDX56_HUMAN*
  accession n: Q9NY93

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TAAYAIPMoxLQLLLHR(K);; $m/Z=(R)IYQAFLMoxSATFNEDVQALK(E);; $m/Z=(R)AVLMEKPDVVVGTPSR(I);; $m/Z=(R)ANNPGIVLTFVLPTEQFHLGK(I);; $m/Z=(R)LFLEQFSIPTCVLNGELPLR(S) }
[Click to access protein entry]
 Spot: 1D-001VAI (nucleoli_hela_1d_human)
 pI: N\A Mw: 16078
 %vol: 0.314714   %od: 0.309768
 ================
 *NH2L1_HUMAN*
  accession n°: P55769

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AYPLADAHLTK(K);; $m/Z=(K)QQIQSIQQSIER(L);; $m/Z=(K)LLDLVQQSCNYK(Q);; $m/Z=(K)KLLDLVQQSCNYK(Q) }
[Click to access protein entry]
 Spot: 1D-001V90 (nucleoli_hela_1d_human)
 pI: N\A Mw: 39648
 %vol: 0.920535   %od: 0.914238
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DELHIVEAEAMNYEGSPIK(V);; $m/Z=(R)TVSLGAGAKDELHIVEAEAMNYEGSPIK(V);; $m/Z=(R)TVSLGAGAKDELHIVEAEAMoxNYEGSPIK(V);; $m/Z=(K)DELHIVEAEAMoxNYEGSPIK(V);; $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(K)MSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(K)LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK(A);; $m/Z=(R)MoxTDQEAIQDLWQWR(K) }
[Click to access protein entry]
 Spot: 1D-001V9E (nucleoli_hela_1d_human)
 pI: N\A Mw: 32202
 %vol: 0.849725   %od: 0.914973
 ================
 *RL7_HUMAN*
  accession n°: P18124

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AGNFYVPAEPK(L);; $m/Z=(R)IALTDNALIAR(S);; $m/Z=(R)KAGNFYVPAEPK(L) }
[Click to access protein entry]
 Spot: 1D-001VAD (nucleoli_hela_1d_human)
 pI: N\A Mw: 17654
 %vol: 1.11723   %od: 1.2229
 ================
 *RL22_HUMAN*
  accession n°: P35268

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)YFQINQDEEEEEDED(-);; $m/Z=(K)AGNLGGGVVTIER(S) }

  ================
 *H2B1L_HUMAN*
  accession n: P99060

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)LLLPGELAK(H);; $m/Z=(K)AMoxGIMoxNSFVNDIFER(I);; $m/Z=(K)AMoxGIMNSFVNDIFER(I) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 901.5 (0), 953.6 (0), 1151.6 (0), 1168.6 (0), 1743.8 (0),
  1759.8 (0), 1775.8 (0) }
[Click to access protein entry]
 Spot: 1D-001V7P (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 0.928403   %od: 0.866836
 ================
 *RRP5_HUMAN*
  accession n°: Q14690

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)DSETVDEDEEVDPALTVGTIK(K);; $m/Z=(K)HELSTEYIPDPER(V) }
[Click to access protein entry]
 Spot: 1D-001V8P (nucleoli_hela_1d_human)
 pI: N\A Mw: 47400
 %vol: 1.32966   %od: 1.48086
 ================
 *RL3_HUMAN*
  accession n°: P39023

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AHLMoxEIQVNGGTVAEK(L);; $m/Z=(K)TVFAEHISDECK(R);; $m/Z=(R)HGSLGFLPR(K) }

  ================
 *EF1A1_HUMAN*
  accession n: P68104

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)IGGIGTVPVGR(V) }

  ================
 *MAK16_HUMAN*
  accession n: Q9BXY0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ALIAAQLDNAIEK(E);; $m/Z=(K)ALEQIDENLIYWPR(F) }
[Click to access protein entry]
 Spot: 1D-001VA4 (nucleoli_hela_1d_human)
 pI: N\A Mw: 21049
 %vol: 1.87254   %od: 0.696703
 ================
 *RL23A_HUMAN*
  accession n°: P62750

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LAPDYDALDVANK(I) }
[Click to access protein entry]
 Spot: 1D-001V80 (nucleoli_hela_1d_human)
 pI: N\A Mw: 87069
 %vol: 1.43981   %od: 1.30117
 ================
 *DHX15_HUMAN*
  accession n°: O43143

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TEMQDNTYPEILR(S);; $m/Z=(R)HQSFVLVGETGSGK(T) }

  ================
 *NUCL_HUMAN*
  accession n: P19338

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GYAFIEFASFEDAK(E);; $m/Z=(K)GFGFVDFNSEEDAK(E) }

  ================
 *NOP2_HUMAN*
  accession n: P46087

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ELLLSAIDSVNATSK(T);; $m/Z=(K)NTGVILANDANAER(L) }

  ================
 *TBL3_HUMAN*
  accession n: Q12788

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)QFAGYSEEVLDVR(F) }

  ================
 *ILF3_HUMAN*
  accession n: Q12906

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VLAGETLSVNDPPDVLDR(Q) }

  ================
 *DDX50_HUMAN*
  accession n: Q9BQ39

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SSDNKLEETLTR(E) }

  ================
 *DDX21_HUMAN*
  accession n: Q9NR30

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)NEEPSEEEIDAPKPKK(M);; $m/Z=(K)LGVCFDVPTASVTEIQEK(W);; $m/Z=(K)EEYQLVQVEQK(A);; $m/Z=(R)GLDIPEVDLVIQSSPPK(D);; $m/Z=(K)STYEQVDLIGK(K);; $m/Z=(R)APQVLVLAPTR(E);; $m/Z=(K)EGAFSNFPISEETIK(L) }
[Click to access protein entry]
 Spot: 1D-001V8O (nucleoli_hela_1d_human)
 pI: N\A Mw: 48630
 %vol: 0.889064   %od: 0.944374
 ================
 *KRR1_HUMAN*
  accession n°: Q13601

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)GLLEESSFATLFPK(Y) }
[Click to access protein entry]
 Spot: 1D-001V8Q (nucleoli_hela_1d_human)
 pI: N\A Mw: 46437
 %vol: 0.731707   %od: 0.745575
 ================
 *RL3_HUMAN*
  accession n°: P39023

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)TVFAEHISDECK(R) }

  ================
 *EF1A1_HUMAN*
  accession n: P68104

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VETGVLKPGMoxVVTFAPVNVTTEVK(S);; $m/Z=(R)LPLQDVYK(I);; $m/Z=(K)YYVTIIDAPGHR(D);; $m/Z=(K)IGGIGTVPVGR(V) }

  ================
 *MAK16_HUMAN*
  accession n: Q9BXY0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ALEQIDENLIYWPR(F);; $m/Z=(R)SSCPLANSQYATIK(E);; $m/Z=(K)ALIAAQLDNAIEK(E);; $m/Z=(R)AYVEIEYEQETEPVAK(A);; $m/Z=(R)NEYSLTGLCNR(S) }

  ================
 *RPF1_HUMAN*
  accession n: Q9H9Y2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)MoxFASLFPHNPQFIGR(Q);; $m/Z=(K)YGEYEWVHKPR(E);; $m/Z=(R)DFTDLIVINEDR(K);; $m/Z=(R)LCEQLSTVIPNSHVYYR(R) }

  ================
 *LYAR_HUMAN*
  accession n: Q9NX58

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ELLEQISAFDNVPR(K);; $m/Z=(M)VFFTCNACGESVK(K) }
[Click to access protein entry]
 Spot: 1D-001V9D (nucleoli_hela_1d_human)
 pI: N\A Mw: 32440
 %vol: 0.715972   %od: 0.657752
 ================
 *RL7A_HUMAN*
  accession n°: P62424

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)KVVNPLFEK(R);; $m/Z=(R)TNYNDRYDEIR(R);; $m/Z=(K)TCTTVAFTQVNSEDK(G);; $m/Z=(R)AGVNTVTTLVENK(K);; $m/Z=(R)LKVPPAINQFTQALDR(Q);; $m/Z=(K)VPPAINQFTQALDR(Q) }
[Click to access protein entry]
 Spot: 1D-001V9L (nucleoli_hela_1d_human)
 pI: N\A Mw: 29157
 %vol: 0.889064   %od: 1.01271
 ================
 *IF6_HUMAN*
  accession n°: P56537

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)TSIEDQDELSSLLQVPLVAGTVNR(G);; $m/Z=(K)LNEAQPSTIATSMR(D) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 1142.6 (0), 1518.8 (0), 1534.8 (0), 1646.7 (0), 2085.1 (0),
  2584.3 (0) }
[Click to access protein entry]
 Spot: 1D-001V86 (nucleoli_hela_1d_human)
 pI: N\A Mw: 75005
 %vol: 1.05429   %od: 0.9565
 ================
 *NOG1_HUMAN*
  accession n°: Q9BZE4

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)IFTDLQSEGFPVIETSTLTEEGVIK(V);; $m/Z=(R)WQVVDTPGILDHPLEDR(N);; $m/Z=(K)QSLEYLEQVR(Q);; $m/Z=(K)YGDSLYRCK(Q) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 873.4 (0), 920.6 (0), 1026.6 (0), 1196.6 (0), 1208.5 (0),
  1245.6 (0), 1264.7 (0), 1466.8 (0), 1681.9 (0), 1825 (0), 1990 (0),
  2341.2 (0), 2753.4 (0) }
[Click to access protein entry]
 Spot: 1D-001VAB (nucleoli_hela_1d_human)
 pI: N\A Mw: 18408
 %vol: 0.487804   %od: 0.492763
 ================
 *RL31_HUMAN*
  accession n°: P62899

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LYTLVTYVPVTTFK(N) }
[Click to access protein entry]
 Spot: 1D-001V91 (nucleoli_hela_1d_human)
 pI: N\A Mw: 38781
 %vol: 1.54996   %od: 1.76822
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)MoxTDQEAIQDLWQWR(K);; $m/Z=(R)MTDQEAIQDLWQWR(K);; $m/Z=(K)VDNDENEHQLSLR(T);; $m/Z=(K)ADKDYHFK(V);; $m/Z=(K)DELHIVEAEAMoxNYEGSPIK(V);; $m/Z=(K)DELHIVEAEAMNYEGSPIK(V);; $m/Z=(K)SNQNGKDSKPSSTPR(S);; $m/Z=(R)SKGQESFK(K);; $m/Z=(K)GPSSVEDIK(A);; $m/Z=(K)MoxQASIEK(G) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 910.5 (0), 931.5 (0), 974.5 (0), 1023.5 (0), 1568.7 (0),
  1819.8 (0), 1835.8 (0), 2145 (0), 2161 (0), 2227.2 (0), 2243.2 (0),
  2929.5 (0), 2945.5 (0) }
[Click to access protein entry]
 Spot: 1D-001V9A (nucleoli_hela_1d_human)
 pI: N\A Mw: 33609
 %vol: 0.959874   %od: 1.01713
 ================
 *MRT4_HUMAN*
  accession n°: Q9UKD2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AAFTVSLDPGPLEQFPHSMoxEPQLR(Q);; $m/Z=(R)TKEEVNEWFTK(Y) }
[Click to access protein entry]
 Spot: 1D-001V8N (nucleoli_hela_1d_human)
 pI: N\A Mw: 49893
 %vol: 0.841857   %od: 0.810615
 ================
 *O95020*
  accession n°: O95020

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)YSESLLGVPIAYDNIK(V) }
[Click to access protein entry]
 Spot: 1D-001V7Y (nucleoli_hela_1d_human)
 pI: N\A Mw: 96301
 %vol: 1.32179   %od: 1.4691
 ================
 *NKRF_HUMAN*
  accession n°: O15226

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SGEGIREPISVK(E);; $m/Z=(K)VILESEVIAEAVGVK(K) }

  ================
 *TOP1_HUMAN*
  accession n: P11387

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)GPVFAPPYEPLPENVK(F);; $m/Z=(K)HLQDLMoxEGLTAK(V);; $m/Z=(R)TYNASITLQQQLK(E);; $m/Z=(K)ELTAPDENIPAK(I) }

  ================
 *NUCL_HUMAN*
  accession n: P19338

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)FGYVDFESAEDLEK(A);; $m/Z=(K)GFGFVDFNSEEDAK(E);; $m/Z=(K)GYAFIEFASFEDAK(E);; $m/Z=(K)ATFIKVPQNQNGK(S);; $m/Z=(K)TLVLSNLSYSATEETLQEVFEK(A);; $m/Z=(K)EVFEDAAEIR(L) }

  ================
 *NOP2_HUMAN*
  accession n: P46087

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LVPTGLDFGQEGFTR(F);; $m/Z=(R)LGVTNTIISHYDGR(Q);; $m/Z=(K)NTGVILANDANAER(L);; $m/Z=(K)ELLLSAIDSVNATSK(T);; $m/Z=(K)GADSELSTVPSVTK(T) }

  ================
 *EXOSX_HUMAN*
  accession n: Q01780

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TEDFIIDTLELR(S);; $m/Z=(K)SDGEMoxVLPGFPDADSFVK(F);; $m/Z=(R)VGILLDEASGVNK(N);; $m/Z=(K)NQQPVLPAGLQVPK(T);; $m/Z=(K)VFHGADSDIEWLQK(D);; $m/Z=(R)SDMYILNESLTDPAIVK(V);; $m/Z=(K)SDGEMVLPGFPDADSFVK(F);; $m/Z=(K)ASGGLPQFGDEYDFYR(S);; $m/Z=(R)SFPGFQAFCETQGDR(L) }

  ================
 *PWP2_HUMAN*
  accession n: Q15269

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AGTLLPVIQFLQK(S);; $m/Z=(R)VLFDPFELDTSVTPGR(V);; $m/Z=(R)GEIEVVTSSLPELYVEK(V);; $m/Z=(K)VLEFLASSFEVSR(H) }

  ================
 *Q9UIX2*
  accession n: Q8IWA0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ELSFVLDYINQSPK(C) }

  ================
 *DDX54_HUMAN*
  accession n: Q8TDD1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VSCAHIYSALDPTAR(K);; $m/Z=(R)LPGGHQTVLFSATLPK(L);; $m/Z=(R)VQELQQGAFGR(G);; $m/Z=(R)GLDIPLLDNVINYSFPAK(G);; $m/Z=(K)CSTLIVTDLAAR(G);; $m/Z=(R)AGLTEPVLIR(L) }

  ================
 *DDX21_HUMAN*
  accession n: Q9NR30

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)EGAFSNFPISEETIK(L);; $m/Z=(R)GRAPQVLVLAPTR(E);; $m/Z=(R)APQVLVLAPTR(E);; $m/Z=(R)GLDIPEVDLVIQSSPPK(D);; $m/Z=(K)NEEPSEEEIDAPKPKK(M) }

  ================
 *WDR3_HUMAN*
  accession n: Q9UNX4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)IFSLLSGEGNVTFNGHK(A);; $m/Z=(R)TLSFSSDNIAVLSAAADSIK(I);; $m/Z=(R)TREPLILEEER(E);; $m/Z=(K)LFNEFIQLGSDVELICR(C);; $m/Z=(R)TEVWGLVLLSEEKR(L) }

  ================
 *NOC2L_HUMAN*
  accession n: Q9Y3T9

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)MoxLQPSSSPLWGK(L);; $m/Z=(R)HISVLVPCFLTFPK(Q);; $m/Z=(R)LEDLNFPEIK(R);; $m/Z=(R)DREIQLEISGK(E);; $m/Z=(R)VSFGVSEQQAVEAWEK(L);; $m/Z=(R)MoxVVVWSTGEESLR(V) }
[Click to access protein entry]
 Spot: 1D-001V92 (nucleoli_hela_1d_human)
 pI: N\A Mw: 38269
 %vol: 1.59717   %od: 1.75536
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VDNDENEHQLSLR(T);; $m/Z=(K)LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK(A);; $m/Z=(R)MoxTDQEAIQDLWQWR(K);; $m/Z=(R)MTDQEAIQDLWQWR(K);; $m/Z=(K)MSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(K)DELHIVEAEAMNYEGSPIK(V);; $m/Z=(R)TVSLGAGAKDELHIVEAEAMoxNYEGSPIK(V);; $m/Z=(R)TVSLGAGAKDELHIVEAEAMNYEGSPIK(V) }

  ================
 *CSK22_HUMAN*
  accession n: P19784

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)HLVSPEALDLLDK(L) }

  ================
 *MK67I_HUMAN*
  accession n: Q9BYG3

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)KGIDYDFPSLILQK(T);; $m/Z=(K)TVDSQGPTPVCTPTFLER(R);; $m/Z=(K)GIDYDFPSLILQK(T);; $m/Z=(K)IVAETMoxNNYLFGER(L);; $m/Z=(K)GYAFVEFESEDVAK(I);; $m/Z=(K)KQEQLTPGVVYVR(H) }
[Click to access protein entry]
 Spot: 1D-001V8K (nucleoli_hela_1d_human)
 pI: N\A Mw: 52788
 %vol: 1.11723   %od: 1.07702
 ================
 *RL4_HUMAN*
  accession n°: P36578

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)RGPCIIYNEDNGIIK(A);; $m/Z=(K)APIRPDIVNFVHTNLR(K);; $m/Z=(R)GPCIIYNEDNGIIK(A);; $m/Z=(R)YAICSALAASALPALVMSK(G);; $m/Z=(R)YAICSALAASALPALVMoxSK(G) }

  ================
 *RBM34_HUMAN*
  accession n: P42696

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LASLFSSLEPQIQPVYVPVPK(Q);; $m/Z=(R)TVFVGNLPVTCNK(K) }

  ================
 *RRP1_HUMAN*
  accession n: P56182

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LQDLAGGIFPEDEIPEK(A) }

  ================
 *Q9BSV5*
  accession n: Q9BSV5

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)RGPCIIYNEDNGIIK(A);; $m/Z=(R)IEEVPELPLVVEDKVEGYK(K);; $m/Z=(R)IEEVPELPLVVEDK(V) }

  ================
 *WDR12_HUMAN*
  accession n: Q9GZL7

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)SIMTIVGHTDVVK(D);; $m/Z=(K)SIMoxTIVGHTDVVK(D) }

  ================
 *RPA49_HUMAN*
  accession n: Q9GZS1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)FEDLLSPAEYEALQSPSEAFR(N);; $m/Z=(K)LGTLSLPLPPAQTSDR(L) }
[Click to access protein entry]
 Spot: 1D-001VA5 (nucleoli_hela_1d_human)
 pI: N\A Mw: 20822
 %vol: 0.660898   %od: 0.667673
 ================
 *NPM_HUMAN*
  accession n°: P06748

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)MSVQPTVSLGGFEITPPVVLR(L);; $m/Z=(K)MoxSVQPTVSLGGFEITPPVVLR(L) }

  ================
 *RL12_HUMAN*
  accession n: P30050

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)HSGNITFDEIVNIAR(Q);; $m/Z=(R)QAQIEVVPSASALIIK(A) }

  ================
 *RS11_HUMAN*
  accession n: P62280

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)DVQIGDIVTVGECRPLSK(T) }

  ================
 *RL23A_HUMAN*
  accession n: P62750

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)LAPDYDALDVANK(I) }

  ================
 *RL11_HUMAN*
  accession n: P62913

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)VLEQLTGQTPVFSK(A) }
[Click to access protein entry]
 Spot: 1D-001V95 (nucleoli_hela_1d_human)
 pI: N\A Mw: 36076
 %vol: 1.45555   %od: 1.55619
 ================
 *FBRL_HUMAN*
  accession n°: P22087

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)LAAAILGGVDQIHIKPGAK(V);; $m/Z=(R)DHAVVVGVYRPPPK(V);; $m/Z=(K)ANCIDSTASAEAVFASEVK(K);; $m/Z=(R)NGGHFVISIK(A);; $m/Z=(R)IVALNAHTFLR(N);; $m/Z=(R)TNIIPVIEDAR(H);; $m/Z=(K)RTNIIPVIEDAR(H) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 981.5 (0), 1017.5 (0), 1071.6 (0), 1240.7 (0), 1254.7 (0),
  1291.7 (0), 1396.8 (0), 1447.8 (0), 1510.7 (0), 1533.9 (0), 1872.1 (0),
  1969.9 (0), 1996 (0), 2098 (0), 2249.1 (0), 2265.1 (0), 2392.1 (0),
  2424.1 (0) }

  ================
 *ROA2_HUMAN*
  accession n: P22626

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)LFIGGLSFETTEESLR(N) }

  ================
 *RL6_HUMAN*
  accession n: Q02878

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)QLASGLLLVTGPLVLNR(V);; $m/Z=(R)ASITPGTILIILTGR(H);; $m/Z=(R)HQEGEIFDTEK(E) }

  ================
 *RPF2_HUMAN*
  accession n: Q9H7B2

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)IELEEMGPSLDLVLR(R);; $m/Z=(R)IELEEMoxGPSLDLVLR(R) }
[Click to access protein entry]
 Spot: 1D-001V8B (nucleoli_hela_1d_human)
 pI: N\A Mw: 65137
 %vol: 1.47128   %od: 1.65687
 ================
 *RL1D1_HUMAN*
  accession n°: O76021

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)KVPVSVNLLSK(N);; $m/Z=(K)ATNESEDEIPQLVPIGK(K);; $m/Z=(K)DDVAPESGDTTVK(K) }

  ================
 *DDX5_HUMAN*
  accession n: P17844

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(R)KIVDQIRPDR(Q);; $m/Z=(R)LMEEIMSEK(E);; $m/Z=(R)ELAQQVQQVAAEYCR(A);; $m/Z=(R)LIDFLECGK(T);; $m/Z=(R)MoxLDMoxGFEPQIR(K);; $m/Z=(R)FGGSRAGPLSGK(K);; $m/Z=(R)GVEICIATPGR(L);; $m/Z=(K)APILIATDVASR(G) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 936.5 (0), 954.5 (0), 963.5 (0), 985.6 (0), 1014.5 (0),
  1094.5 (0), 1096.5 (0), 1129.7 (0), 1172.6 (0), 1226.7 (0), 1295.6 (0),
  1336.6 (0), 1368.7 (0), 1389.7 (0), 1793.9 (0), 2132 (0), 2361.3 (0),
  2441.3 (0), 2457.3 (0) }

  ================
 *GNL3_HUMAN*
  accession n: Q9BVP2

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(K)KLVLILNK(S);; $m/Z=(K)SGFNLEELEK(N);; $m/Z=(K)LLGGFQETCSK(A);; $m/Z=(K)IIEEDDAYDFSTDYV(-);; $m/Z=(K)DIHEELPK(R);; $m/Z=(R)VGVIGFPNVGK(S) }

  ================
 *UTP6_HUMAN*
  accession n: Q9NYH9

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ELEIESQTEEQPTTK(Q) }

  ================
 *DDX52_HUMAN*
  accession n: Q9Y2R4

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AITFFTEDDKPLLR(S) }

  ================
 *NOP58_HUMAN*
  accession n: Q9Y2X3

   Identification Methods:
  * MAPPING: {MS/MS} {PMF}

  peptide sequences: {
 $m/Z=(R)YDAFGEDSSSAMoxGVENR(A);; $m/Z=(K)LSELLPEEVEAEVK(A);; $m/Z=(R)EMoxAAMoxCLGLAHSLSR(Y);; $m/Z=(K)LNLSCIHSPVVNELMR(G);; $m/Z=(K)LNLSCIHSPVVNELMoxR(G);; $m/Z=(K)HAASTVQILGAEK(A);; $m/Z=(K)IISDNLTYCK(C);; $m/Z=(K)ELNNYIMoxRCR(E);; $m/Z=(K)TYDPSGDSTLPTCSK(K) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 975.5 (0), 1327.7 (0), 1398.7 (0), 1414.7 (0), 1584.8 (0),
  1733.9 (0), 1834.8 (0), 1850.8 (0), 1959 (0), 2122 (0)
  }
[Click to access protein entry]
 Spot: 1D-001V7L (nucleoli_hela_1d_human)
 pI: N\A Mw: 94000
 %vol: 1.64437   %od: 1.25818
 ================
 *PRKDC_HUMAN*
  accession n°: P78527

   Identification Methods:
  * MAPPING: {MS/MS}

  ================
 *PWP2_HUMAN*
  accession n: Q15269

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)VLFDPFELDTSVTPGR(V) }

  ================
 *Q9UIX2*
  accession n: Q8IWA0

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)ELSFVLDYINQSPK(C);; $m/Z=(R)NLEASAVIQGLVK(D) }
[Click to access protein entry]
 Spot: 1D-001V9Z (nucleoli_hela_1d_human)
 pI: N\A Mw: 22743
 %vol: 0.542879   %od: 0.618801
 ================
 *NHP2_HUMAN*
  accession n°: Q9NX24

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)TYQELLVNQNPIAQPLASR(R) }
[Click to access protein entry]
 Spot: 1D-001VAE (nucleoli_hela_1d_human)
 pI: N\A Mw: 17312
 %vol: 0.401259   %od: 0.422578
 ================
 *RL23_HUMAN*
  accession n°: P62829

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)ISLGLPVGAVINCADNTGAK(N) }

  ================
 *H2B1L_HUMAN*
  accession n: P99060

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)AMoxGIMoxNSFVNDIFER(I) }
[Click to access protein entry]
 Spot: 1D-001V8S (nucleoli_hela_1d_human)
 pI: N\A Mw: 45031
 %vol: 0.826121   %od: 0.82862
 ================
 *ACTG_HUMAN*
  accession n°: P63261

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)AVFPSIVGRPR(H);; $m/Z=(K)SYELPDGQVITIGNER(F);; $m/Z=(R)VAPEEHPVLLTEAPLNPK(A);; $m/Z=(K)DLYANTVLSGGTTMoxYPGIADR(M) }

  ================
 *HNRPD_HUMAN*
  accession n: Q14103

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)IFVGGLSPDTPEEK(I) }

  ================
 *PK1IP_HUMAN*
  accession n: Q9NWT1

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(R)FFDCDSLVCLCEFK(A);; $m/Z=(K)IEHGALVHHSGTITCLK(F);; $m/Z=(K)IDIYQLDTASISGTITNEK(R);; $m/Z=(K)FLSESVLAVAGDEEVIR(F);; $m/Z=(K)DETIHIYDMoxK(K) }
[Click to access protein entry]
 Spot: 1D-001VA9 (nucleoli_hela_1d_human)
 pI: N\A Mw: 19089
 %vol: 0.778913   %od: 0.885577
 ================
 *RL35_HUMAN*
  accession n°: P42766

   Identification Methods:
  * MAPPING: {MS/MS}

  peptide sequences: {
 $m/Z=(K)QLDDLKVELSQLR(V) }

  ================
 *RL27A_HUMAN*
  accession n: P46776

   Identification Methods:
  * MAPPING: {PMF,MS/MS}

  peptide sequences: {
 $m/Z=(K)VGMKHYHLK(R) }

  peptide masses:  {  (TRYPSIN)
 $m/Z= 968.5 (0), 1111.6 (0), 1232.7 (0), 1422.7 (0)
  }
SWISS-2DPAGE image

 SWISS-2DPAGE Viewer
 NUCLEOLI_HELA_1D_HUMAN { SDS-PAGE of nucleolar proteins from Human HeLa cells } (All identified proteins)

             Back to the
SWISS-2DPAGE imagesearch engine

Switch to Gel: 


Re-scale Gel from 100% to:  View: 


      Display:   Identified spots    Identification details:  show hide
details:  PMF  Tandem MS  AA Composition  Micro-Sequencing / Tagging  Gel Matching  Comigration  Immunobloting
 

  -Get more information by dragging your mouse pointer over any highlighted spot  -Click on a highlighted spot to access all its associated protein entries
/swiss-2dpage/data/gifs/swiss_2dpage/NUCLEOLI_HELA_1D_HUMAN.gif
Back to the
SWISS-2DPAGE imagesearch engine