Attention: World-2DPAGE is no longer maintained.
World-2DPAGE Repository no longer accepts submissions.
[Click to access protein entry]
Spot: 591 (ob21dsub)
pI: 5.86 Mw: 30000
%vol: 0.0357633 %od: 0.0521544
================
*PSB7_RAT*
accession n°: Q9JHW0
Identification Methods:
* MAPPING: {MS/MS} {PMF}
peptide sequences: {
$m/Z=DGIVLGADTR;; $m/Z=MLKQMLFR;; $m/Z=YQGYIGAALVLGGVDVTGPHLYSIYPHGSTDK;; $m/Z=LPYVTMoxGSGSLAAMoxAVFEDK;; $m/Z=FRPDMoxEEEEAK;; $m/Z=FRPDMoxEEEEAKK;; $m/Z=LDFLRPYSVPNKK }
peptide masses: { (TRYPSIN)
$m/Z= 1016.5797 (0), 1066.5514 (0), 1396.6536 (0),
1524.7445 (0), 1576.9519 (0), 2119.0261 (0), 3348.679 (0)
}
Spot: 591 (ob21dsub)
pI: 5.86 Mw: 30000
%vol: 0.0357633 %od: 0.0521544
================
*PSB7_RAT*
accession n°: Q9JHW0
Identification Methods:
* MAPPING: {MS/MS} {PMF}
peptide sequences: {
$m/Z=DGIVLGADTR;; $m/Z=MLKQMLFR;; $m/Z=YQGYIGAALVLGGVDVTGPHLYSIYPHGSTDK;; $m/Z=LPYVTMoxGSGSLAAMoxAVFEDK;; $m/Z=FRPDMoxEEEEAK;; $m/Z=FRPDMoxEEEEAKK;; $m/Z=LDFLRPYSVPNKK }
peptide masses: { (TRYPSIN)
$m/Z= 1016.5797 (0), 1066.5514 (0), 1396.6536 (0),
1524.7445 (0), 1576.9519 (0), 2119.0261 (0), 3348.679 (0)
}
 |
World-2DPAGE Repository Viewer (0004)
Home page of the World-2DPAGE Repository
|
Back to the search engine |
-Get more information by dragging your mouse pointer over any highlighted spot -Click on a highlighted spot to access all its associated protein entries
Back to the
search engine