World-2DPAGE Home
Home  |  Contact


World-2DPAGE Repository 
Search by  [accession number] *
[description, ID or gene] 
[author names] 
[spot ID / serial number] 
[identification methods] 
[pI / Mw range] 
[combined fields] 

Maps  [experimental info] 
[protein list] 
[graphical interface]

     Databases

use 'Ctrl' to select several
databases


Select Remote Interfaces
[All Interfaces]
SWISS-2DPAGE
World-2DPAGE Portal

Exclude local DBs
has only effect if a remote
interface is selected
     
Searching in 'World-2DPAGE Repository [0004]' for entry matching: DPYL1_RAT




World-2DPAGE Repository (0004): DPYL1_RAT



DPYL1_RAT:

Nice View - a user-friendly view of this entry
ID   DPYL1_RAT;
AC   Q62950;
DT   13-Oct-2008, integrated into [0004] - Proteome profile of the mature rat
DT   Olfactory bulb (release 1).
DT   18-May-2011, 2D annotation version 2.
DT   22-Dec-2011, general annotation version 2.
DE   RecName: Full=Dihydropyrimidinase-related protein 1; Short=DRP-1;
DE   AltName: Full=Collapsin response mediator protein 1; Short=CRMP-1;.
GN   Name=Crmp1; Synonyms=Dpysl1;
OS   Rattus norvegicus (Rat).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;
OC   Muroidea; Muridae; Murinae; Rattus.
OX   NCBI_TaxID=10116;
IM   OB21DSUB.
RN   [1]
RP   MAPPING ON GEL.
RX   PubMed=19343716; DOI=10.1002/pmic.200800664; [NCBI, EBI, Israel, Japan]
RA   Maurya D.K., Sundaram C.S., Bhargava P.;
RT   ''Proteome profile of the mature rat olfactory bulb'';
RL   Proteomics 9(1):2593-2599 (2009).
2D   -!- MASTER: OB21DSUB;
2D   -!-   PI/MW: SPOT 268=6.39/58000;
2D   -!-   PI/MW: SPOT 271=6.75/58000;
2D   -!-   PEPTIDE MASSES: SPOT 268: 922.5267; 1000.5927; 1001.5743;
2D         1314.7102; 1405.7859; 1802.8959; 2065.0491; 2175.168; 2199.0337;
2D         2215.0315; 2227.0464; 2331.167; 2403.189; 2531.2751; 2781.3157;
2D         2797.3044; 2841.4683; 2951.4788; 2967.4897; 3389.6189; 3405.6006; TRYPSIN.
2D   -!-   PEPTIDE MASSES: SPOT 271: 844.4854; 922.5212; 1000.5909; 1001.5665;
2D         1314.7024; 1405.7723; 1422.6744; 1759.9481; 1802.8947; 1958.9924;
2D         1974.9681; 2175.158; 2214.9929; 2227.0405; 2331.1697; 2403.1746;
2D         2951.439; 2967.4502; TRYPSIN.
2D   -!-   PEPTIDE SEQUENCES: SPOT 268: IINDDQSFYADVYLEDGLIK,24-43;
2D         QIGENLIVPGGVKTIEANGR,44-63; MoxVIPGGIDVNTYLQKPSQGMoxTSADDFFQGTR,64-94;
2D         MoxVIPGGIDVNTYLQKPSQGMTSADDFFQGTR,64-94;
2D         AALAGGTTMIIDHVVPEPGSSLLTSFEK,95-122; DLYQMoxSDSQLYEAFTFLK,172-189;
2D         DLYQMSDSQLYEAFTFLK,172-189; GLGAVILVHAENGDLIAQEQK,190-210;
2D         ILEMGITGPEGHALSRPEELEAEAVFR,212-238;
2D         ILEMoxGITGPEGHALSRPEELEAEAVFR,212-238; SAADIIALAR,259-268;
2D         KGPLVFGEPIAASLGTDGTHYWSK,270-293; GPLVFGEPIAASLGTDGTHYWSK,271-293;
2D         DNFTLIPEGVNGIEER,346-361; MTVVWDKAVATGK,362-374; IFNLYPR,391-397;
2D         STVEYNIFEGMECcamHGSPLVVISQGK,427-451;
2D         STVEYNIFEGMoxECcamHGSPLVVISQGK,427-451; KPFPEHLYQR,472-481;
2D         VFGLHSVSR,488-496; NLHQSNFSLSGAQIDDNNPR,533-552.
2D   -!-   PEPTIDE SEQUENCES: SPOT 271: IINDDQSFYADVYLEDGLIK,24-43;
2D         GVNSFQVYMoxAYK,160-171; DLYQMoxSDSQLYEAFTFLK,172-189;
2D         GLGAVILVHAENGDLIAQEQK,190-210; ILEMGITGPEGHALSRPEELEAEAVFR,212-238;
2D         ILEMoxGITGPEGHALSRPEELEAEAVFR,212-238; AIAIAGRINCcamPVYITK,239-254;
2D         SAADIIALAR,259-268; GPLVFGEPIAASLGTDGTHYWSK,271-293;
2D         DNFTLIPEGVNGIEER,346-361; MTVVWDKAVATGK,362-374; IFNLYPR,391-397;
2D         IAVGSDADVVIWDPDKMK,401-418; IAVGSDADVVIWDPDKMoxK,401-418;
2D         KPFPEHLYQR,472-481; VFGLHSVSR,488-496; HQPPPIR,526-532; NLHQSNFSLSGAQIDDNNPR,533-552.
2D   -!-   MAPPING: SPOT 268: Peptide mass fingerprinting [1]; SPOT 268:
2D         Tandem mass spectrometry [1]; SPOT 271: Peptide mass fingerprinting [1];
2D         SPOT 271: Tandem mass spectrometry [1].
CC   ---------------------------------------------------------------------------
CC   Data from Dr. Purnima Bhargava, Centre for Cellular and Molecular Biology, India
CC   ---------------------------------------------------------------------------
DR   UniProtKB/Swiss-Prot; Q62950; DPYL1_RAT.
//


The following 2-D map is available for this protein:
2-DE gel for Olfactory bulb proteome
OB21DSUB


World-2DPAGE Repository image

World-2DPAGE Repository (search AC)


Database constructed and maintained by SIB, using the Make2D-DB II package (ver. 3.10.2) from the World-2DPAGE Constellation of the ExPASy web server