World-2DPAGE Home
Home  |  Contact


World-2DPAGE Repository 
Search by  [accession number] 
[description, ID or gene] 
[author names] 
[spot ID / serial number] *
[identification methods] 
[pI / Mw range] 
[combined fields] 

Maps  [experimental info] 
[protein list] 
[graphical interface]

     Databases

use 'Ctrl' to select several
databases


Select Remote Interfaces
[All Interfaces]
SWISS-2DPAGE
World-2DPAGE Portal

Exclude local DBs
has only effect if a remote
interface is selected
     

Searching in 'World-2DPAGE Repository [0004]' experimental data (all)
for spot names matching (exactly): '373'
on the 'OB21DSUB' map.



Searched entry

Spot ID AC
(ID)
PMF Tandem MS Identified peptides Amino acid composition
373 P10719
(ATPB_RAT)



1038.6235; 1278.6752; 1385.7509; 1401.7396; 1406.7268; 1435.7926; 1601.8574; 1650.9573; 1831.9027; 1919.1407; 1922.0114; 1988.0708; 2039.0228; 2077.0068; 2266.137; 2282.1208; 2334.1582; 2691.3984; 3714.8994; 3842.988; TRYPSIN

no data LVLEVAQHLGESTVR,95-109; TIAMoxDGTEGLVR,110-121; VLDSGAPIKIPVGPETLGR,125-143; IPVGPETLGR,134-143; IMNVIGEPIDER,144-155; IMoxNVIGEPIDER,144-155; AHGGYSVFAGVGER,226-239; TREGNDLYHEMoxIESGVINLK,240-259; EGNDLYHEMoxIESGVINLK,242-259; VALVYGQMNEPPGAR,265-279; DQEGQDVLLFIDNIFR,295-310; FTQAGSEVSALLGR,311-324; IPSAVGYQPTLATDMGTMQER,325-345; IPSAVGYQPTLATDMoxGTMQER,325-345; KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR,351-387; GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR,352-387; AIAELGIYPAVDPLDSTSR,388-406; IMoxDPNIVGSEHYDVAR,407-422; SLQDIIAILGMoxDELSEEDKLTVSR,433-456; FLSQPFQVAEVFTGHMoxGK,463-480 no data


World-2DPAGE Repository image

World-2DPAGE Repository (search Spot)


Database constructed and maintained by SIB, using the Make2D-DB II package (ver. 3.10.2) from the World-2DPAGE Constellation of the ExPASy web server