World-2DPAGE Home
Home  |  Contact


World-2DPAGE Repository 
Search by  [accession number] 
[description, ID or gene] 
[author names] 
[spot ID / serial number] *
[identification methods] 
[pI / Mw range] 
[combined fields] 

Maps  [experimental info] 
[protein list] 
[graphical interface]

     Databases

use 'Ctrl' to select several
databases


Select Remote Interfaces
[All Interfaces]
SWISS-2DPAGE
World-2DPAGE Portal

Exclude local DBs
has only effect if a remote
interface is selected
     

Searching in 'World-2DPAGE Repository [0004]' experimental data (Tandem MS)
for spot names matching (exactly): '373'
on the 'OB21DSUB' map.



Searched entry

Spot ID AC
(ID)
Tandem MS Identified peptides
373 P10719
(ATPB_RAT)
no data LVLEVAQHLGESTVR,95-109; TIAMoxDGTEGLVR,110-121; VLDSGAPIKIPVGPETLGR,125-143; IPVGPETLGR,134-143; IMNVIGEPIDER,144-155; IMoxNVIGEPIDER,144-155; AHGGYSVFAGVGER,226-239; TREGNDLYHEMoxIESGVINLK,240-259; EGNDLYHEMoxIESGVINLK,242-259; VALVYGQMNEPPGAR,265-279; DQEGQDVLLFIDNIFR,295-310; FTQAGSEVSALLGR,311-324; IPSAVGYQPTLATDMGTMQER,325-345; IPSAVGYQPTLATDMoxGTMQER,325-345; KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR,351-387; GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR,352-387; AIAELGIYPAVDPLDSTSR,388-406; IMoxDPNIVGSEHYDVAR,407-422; SLQDIIAILGMoxDELSEEDKLTVSR,433-456; FLSQPFQVAEVFTGHMoxGK,463-480


World-2DPAGE Repository image

World-2DPAGE Repository (search Spot)


Database constructed and maintained by SIB, using the Make2D-DB II package (ver. 3.10.2) from the World-2DPAGE Constellation of the ExPASy web server