resource logo

SWISS-2DPAGE

Attention: World-2DPAGE is no longer maintained.
It will be discontinued on 31-May-2024.

Swiss-2DPAGE data (text records and image files) will continue to be available from https://ftp.expasy.org/databases/swiss-2dpage/.


SWISS-2DPAGE 
Search by  [accession number] *
[description, ID or gene] 
[author names] 
[spot ID / serial number] 
[identification methods] 
[pI / Mw range] 
[combined fields] 

Maps  [experimental info] 
[protein list] 
[graphical interface]

     Select Remote Interfaces
[All Interfaces]
World-2DPAGE Portal
World-2DPAGE Repository

Exclude local DBs
has only effect if a remote
interface is selected
     

Sample Preparation and Post-separation Analysis



Searching in 'SWISS-2DPAGE' for entry matching: P56182




SWISS-2DPAGE: P56182



P56182:

Nice View - a user-friendly view of this entry
ID   RRP1_HUMAN; STANDARD; 2DG.
AC   P56182;
DT   15-MAY-2003, integrated into SWISS-2DPAGE (release 16).
DT   15-MAY-2003, 2D annotation version 1.
DT   19-MAY-2011, general annotation version 6.
DE   RecName: Full=Ribosomal RNA processing protein 1 homolog A; AltName:
DE   Full=Novel nuclear protein 1; Short=NNP-1; AltName: Full=Nucleolar
DE   protein Nop52; AltName: Full=RRP1-like protein;.
GN   Name=RRP1; Synonyms=D21S2056E, NNP1, NOP52, RRP1A;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini;
OC   Hominidae; Homo.
OX   NCBI_TaxID=9606;
MT   NUCLEOLI_HELA_1D_HUMAN.
IM   NUCLEOLI_HELA_1D_HUMAN.
RN   [1]
RP   MAPPING ON GEL.
RX   PubMed=12429849; [NCBI, Expasy, EBI, Israel, Japan]
RA   Scherl A., Coute Y., Deon C., Calle A., Kindbeiter K., Sanchez J.-C.,
RA   Greco A., Hochstrasser D.F., Diaz J.-J.;
RT   ''''''Functional proteomic analysis of human nucleolus'';'';'';
RL   Mol. Biol. Cell. 13(1):4100-4109(2002).
1D   -!- MASTER: NUCLEOLI_HELA_1D_HUMAN;
1D   -!-   MW: BAND 1D-001V8J=53744;
1D   -!-   MW: BAND 1D-001V8K=52788;
1D   -!-   PEPTIDE SEQUENCES: BAND 1D-001V8J: (R)VQLPPEIQLAQR(L),5-16;
1D         (R)AAGGFTHDELLK(V),43-54; (K)VGAEELTADQNLK(F),180-192;
1D         (R)AEPEAGEEQAGDDRDSGGPVLQFDYEAVANR(L),276-306;
1D         (R)KLQDLAGGIFPEDEIPEK(A),330-347; (K)LQDLAGGIFPEDEIPEK(A),331-347.
1D   -!-   PEPTIDE SEQUENCES: BAND 1D-001V8K: (K)LQDLAGGIFPEDEIPEK(A),331-347.
1D   -!-   MAPPING: Tandem mass spectrometry [1].
CC   ---------------------------------------------------------------------------
CC   This SWISS-2DPAGE entry is copyright the Swiss Institute of Bioinformatics.
CC   There are no restrictions on its use by non-profit institutions as long as
CC   its content is in no way modified and this statement is not removed.
CC   Usage by and for commercial entities requires a license agreement (See
CC   http://world-2dpage.expasy.org/swiss-2dpage/docs/license.html or send email from legal@sib.swiss).
CC   ---------------------------------------------------------------------------
DR   UniProtKB/Swiss-Prot; P56182; RRP1_HUMAN.
//


The following 2-D map is available for this protein:
SDS-PAGE of nucleolar proteins from Human HeLa cells
NUCLEOLI_HELA_1D_HUMAN


SWISS-2DPAGE image

SWISS-2DPAGE (search AC)


Database constructed and maintained by SIB, using the Make2D-DB II package (ver. 3.10.2) from the World-2DPAGE Constellation of the Expasy web server